KEGG   Leishmania donovani: LDBPK_150050Help
Entry
LDBPK_150050      CDS       T02289                                 

Definition
cytochrome-b5 reductase, putative
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ldo  Leishmania donovani
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LDBPK_150050
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LDBPK_150050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15:complement(10257..11096)
Genome map
AA seq 279 aa AA seqDB search
MWSTTQQSEHLAAKCAKKPVNTFSPDSYKPFKLISSRYESHDTRRFYFALDSPDDSFYMP
VASCIIAKYTDADGKDVARPYTPISSNSTKGHFELVVKKYPKGKMGNYLFSMQPGDELLV
KGPFEKFAYKPNMWKHVGMIAGGTGISPMYQVIRAVLENPKDKTNISLIYANNQRRDILL
ANELIEMQKVYNNFNMYLTLLEVPHRWLGGIGYVNSAMVTTFMPKPGEKNTKILVCGPPP
MMQAISGDKLFEPGKPPQQGQVSGLLKTLGYTEEQVFKY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtaccacgcagcagtcggagcacttagcggccaagtgtgccaagaaaccagtg
aacacgttctcccccgatagctacaagccattcaagttgatttcctctcggtacgagtcg
cacgatacgcgccgcttttactttgccctcgatagccccgatgatagcttctacatgcca
gttgcttcgtgcattatcgcgaagtacaccgatgcagacggcaaggacgttgctcggcca
tacactcccatctcctctaatagcaccaagggccactttgaactcgttgtgaagaagtat
ccaaaaggaaaaatgggcaactatctgttctccatgcaaccaggcgacgaactgctcgtc
aagggcccctttgagaagtttgcgtacaagcccaacatgtggaagcacgtgggcatgatt
gccggcggcaccggcatctctccaatgtaccaggtgattcgtgccgtgctagagaatccc
aaggacaagaccaacatttctctcatctatgccaacaaccaacgccgcgacattctgctt
gctaacgagctgattgagatgcagaaggtctacaacaacttcaacatgtatttgaccctt
ctggaggtgccgcaccggtggctaggcggtatcggctatgtgaatagtgccatggtaacc
acctttatgccgaagccgggggagaagaacacgaagatcctcgtatgtggcccccctccg
atgatgcaggccatcagcggcgacaagctatttgagcctggcaagccgcctcagcagggc
caggtaagtggcctgctgaaaacgctaggctacacggaggagcaggtcttcaagtactga

DBGET integrated database retrieval system