KEGG   Leishmania donovani: LDBPK_171200Help
Entry
LDBPK_171200      CDS       T02289                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase-like protein
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     LDBPK_171200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17:524073..525695
Genome map
AA seq 540 aa AA seqDB search
MSADARIAIIAVVHLALTWVLLRYIADSAMPFYVHREGSSPAGAANGASVRRAVAHEWDQ
WSPFLVPSQEAYAAQLGRQQRATSAADAVALNSRVVWRSSAFHLTLAIFTYALLRFGVTA
PYGRHSWALGFQLTLPSRVSWMLQESPTIFQVIYHVFLEYPRLMGHSPSWPSLWPSSSSA
SGPTAAGMPSSHSSADTCHSYWGCVRAACTQQHLGLLLFVIHYVHRSWLYPLSIPATAHD
VPLVVTWMATMYCLFNGRLQVLASAGAAATACATDTAAPSLACTPAYTASMGFVRCWRER
HELQSLHSSSASVGAVAVRVGWRLLLGLYAIGVLGGSALFFLGQRINMQADYYLVRLRRG
DKGSISHGGSKPVGRRAANLHGDALATSSSLEASRDAQHRSSIDGYRIPVGGWFDSVSCA
NFFGELVEWTGYVIVVAATSATSNGNCLSVTTALEEELLQPLSSSSWWSLMNPIMWLRLV
ARVFFGGSESRPAALAAFSFLVYVFSNLAPRAVAHHAWYAKTFGDPYTRLGRQALIPGVY
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgatgcgcgtattgctatcatcgccgtcgtgcaccttgcgctgacgtgggta
ctgctgcgctacatcgccgattcggccatgcccttctacgtgcaccgcgaaggcagcagc
cctgccggtgccgccaacggtgcctctgttcgcagggcggtagcgcacgaatgggaccag
tggtcgcccttcctcgtgccgagccaggaggcgtacgctgcacagctcggccgacagcag
cgcgcgacatcggctgccgatgctgtcgccctcaacagtcgtgtggtgtggcgcagcagc
gcgttccacctcacgctcgccatcttcacatacgcgttgctgaggtttggcgttacggcc
ccgtacggccgtcactcctgggccctcggcttccagcttaccctcccctcgcgcgtcagc
tggatgttgcaggagagtccgaccatcttccaggtgatctaccacgtttttctggagtat
ccgcgcctcatggggcacagcccttcatggccatcgctgtggccatcgtcctcctctgcc
tccggcccgactgctgctgggatgcccagcagccattcttcggcggacacatgccattcc
tactggggctgtgtgcgggccgcctgcacgcagcagcaccttggactcctgctctttgtt
atccactacgtccaccgcagctggctctatccgctgtcgatccccgccaccgcacatgat
gtgccgctcgtcgttacgtggatggcgaccatgtactgtctcttcaatggccgcctacag
gtgctggcgagcgcaggtgcggctgccacggcctgtgcaaccgacacagcagcgccgtct
ttggcatgcactcccgcgtacacggcgtcgatgggctttgtgcggtgttggcgcgagcgc
cacgagctgcagtccctccactcctcctccgcctccgtcggagctgtcgcggttcgcgtt
ggctggcggcttcttttgggcctctacgctattggcgtcttgggcggctcagcgctgttc
ttcctcggacaaaggattaacatgcaggcggactactacctggtgcgtctgcgccgcggt
gacaagggcagcatcagccacggtggcagcaagccggtcggacggagggcggcgaatctg
cacggggatgcgctggcgacgtcgtcgtcgcttgaggcgtctcgtgatgctcagcaccgc
agcagcattgacggctatcgcatccccgtcggcggctggtttgactccgtcagctgcgcg
aacttcttcggcgagcttgtcgagtggacgggctacgtcatcgtcgtcgcggcgacttct
gctactagcaacggcaactgcctctccgtgacgactgccctcgaggaggaactacttcaa
ccgctctcgtcgtcgtcttggtggtcactgatgaacccgatcatgtggctgcgcctcgtt
gcgcgcgtgttcttcggcgggtcggagtcacgcccggcagcgctggcggcgtttagcttc
ctggtgtacgtcttcagcaacttggccccgcgtgcggtggcgcatcatgcgtggtacgcc
aagacgttcggtgatccctacacgaggctcggccgccaggcgctcatacccggtgtgtac
tag

DBGET integrated database retrieval system