KEGG   Leishmania donovani: LDBPK_180990Help
Entry
LDBPK_180990      CDS       T02289                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ldo  Leishmania donovani
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LDBPK_180990
   00052 Galactose metabolism
    LDBPK_180990
   00500 Starch and sucrose metabolism
    LDBPK_180990
   00520 Amino sugar and nucleotide sugar metabolism
    LDBPK_180990
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LDBPK_180990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18:407463..408947
Genome map
AA seq 494 aa AA seqDB search
MENDMKSLSAAAQACVKKMRDAKVNEACIRTFIAQHVMVSKGETGSIPDSAIMPVDSLDA
LDSLTIECDNAVLQSTVVLKLNGGLGTGMGLHDAKTLLEVKDGKTFLDFTALQVQYLRQH
CSEHLRFMLMDSFNTSASTKSFLKARYPWLYQVFDSEVELMQNQVPKILQDTLEPAAWAE
DPGCEWAPPGHGDIYTALYGSGKLQELVKQGYRYMFVSNGDNLGATIDKRVLAYMEREKI
DFLMEVCRRTESDKKGGHLARQTVYVEGKDGQPDAEKRGLLLRESAQCPKADMESFQDIN
KYSFFNTNNLWIRLPVLLEMMKEHGGTLPLPVIRNEKTVDPSKSASPKVYQLETAMGAAI
AMFESASAIVVPRSRFAPVKTCADLLALRSDAYVVTDDFRLVLDDRCHGHPPVVDLDSAH
YKMMSGFEKLVQHGVPSLVECKSVTVKGLVQFGAGNVLAGTVKIENADSASAFVIPDGAK
LNDTTASPPQSTDK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgacatgaagtctctcagcgccgccgctcaggcgtgcgtaaagaagatgcgc
gacgccaaggtgaacgaggcgtgcatccgcaccttcatcgcacagcacgtcatggtcagt
aaaggcgagacggggtccattcccgactccgccatcatgccggtcgactccctcgatgcc
ctggacagcctcaccattgagtgcgacaacgctgtcctgcagagcaccgttgtgctgaag
ctgaacggcggcctcggcaccggcatggggctgcacgacgccaagacgctgctcgaggtc
aaggatggcaagacgtttcttgactttacagcgcttcaggtacagtaccttcgccagcac
tgcagcgagcatctgcgctttatgttgatggacagcttcaacacctccgctagcaccaag
agctttctgaaggcgcgctacccgtggctgtaccaggtctttgactctgaggtagagctg
atgcagaaccaggtgcccaaaatactgcaggacacgctcgagcccgcggcctgggccgag
gacccggggtgcgagtgggcgccgccggggcacggtgacatctacaccgctttgtatggc
tccggcaagctacaggaactcgtcaagcagggctaccgctacatgttcgtcagcaacggc
gacaacctcggcgccaccatcgacaagcgcgtgctggcgtacatggagagggagaagatc
gactttctgatggaggtgtgccgccgaacggagagcgacaagaaaggcggtcacctggct
cggcagacggtgtatgtggagggcaaggacggtcaaccagacgccgagaagagggggctg
ctgctgcgggaatcggcccagtgccccaaggcggacatggaaagcttccaggacatcaac
aaatactccttcttcaacacgaacaacctatggatcaggctcccggtgctgctggagatg
atgaaggagcacggcggcacgctgccgctgccggtcatccgcaacgagaagacggtcgat
ccatctaaatcagcatcacccaaggtgtaccagctggaaactgccatgggcgccgcgatc
gccatgttcgaaagcgcatcggccattgtcgtgccacgcagccgcttcgcgccagtgaag
acgtgcgccgatctgctcgctctgcgctccgacgcctacgtcgtgacggacgacttccgc
ctcgtcctggacgaccgctgccacggccacccgcccgtcgtcgacctcgacagcgcgcac
tacaagatgatgagcggctttgagaagcttgtgcaacacggcgtgccatcgctggtcgag
tgcaagagcgtgacagtgaaggggctggttcagttcggcgctggcaacgttctcgcaggc
acggtcaagattgagaacgcggacagcgcctcggcgttcgtgatccccgatggcgccaag
ctaaacgacacaacggcgtcaccgccgcagtcgacagacaagtag

DBGET integrated database retrieval system