KEGG   Leishmania donovani: LDBPK_181040Help
Entry
LDBPK_181040      CDS       T02289                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ldo  Leishmania donovani
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ldo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18:424689..427166
Genome map
AA seq 825 aa AA seqDB search
MRRRVVDTEGGAVHVSGSAPTWRGRRSRRAFFSLLLLSIALSAMICSLLVLGWIAADDST
TVFGDDFAASDAWLNSNSNQEKWQRALLQSAKLNLPVPHSVAMNQVFFISCNRHDRSQLY
WAYMAVAAQCEMLSWKNATAAPPCRRLYAGVSSLLRTAGTAASSGGPHGRTTDTDEGKWQ
EAVPLGACGSVYDSPAAAEQRQRYRRTSPPLLLLDETPPPLHRDTDPEQCFRAAPRDAVY
STGVPVDALIWLGDIIYADKFPDGRDAQSLLFHHVNTMVSIGRFWRIQRDAPEYNAFIDS
CVAGGDHLDWTLHSPGEVFLPAAADNRERVVQLTPSPSSGTHRNVWATWDDHDMGENDGG
REYTGRNSTQRFFLNFLRAPSSDPRWRREGVYGAYTTDFRDVVDDAKGWGTPMRLLMQQL
YEHAICVVLLDVRSFRDRPNATQAGDMLGAEQWAWFEELLQNYTTLTRDGRERCAMVLIG
GGIQFILDEKPAENWAAFPRSRDRLLGLLQAYRVERVAFITGDVHMGELGADFTKHAIEE
VLGYPIVEATSSGLTHSANMYFLPTFMPLLFPSPRRLGLYVGTNFGALRLSLDLRHLPLI
RSYLTEMEAKMAAARFRPPQWRREVRAAVEQVVNATFTIFSIPKGGQPVYRLNFPLSMLT
YAHGVAYRDATVDAVHGSVHKKPTSSPAAPEKNGGKEAAKDDTERTSSSPLRALLVLKNG
TITGIAHYRNTEPTPLITWSARQLQYYIFTNFSVSETLKLMILLGFSAGALVLLLLMTTL
CRYLRRPRNSCGRFYYSSVAPSPQVSLVTRCSKKRVNNQWNNIDK
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgtgtcgttgatacagagggcggcgcggtgcatgtcagtggctccgcacca
acttggcgaggccggcggtcccggcgcgccttcttctctctcttgctgctctccatcgcg
ctgtccgctatgatatgttccctgcttgtcctgggctggatcgcagccgatgactcgact
actgttttcggcgacgacttcgcagccagcgacgcttggttgaactccaatagcaaccaa
gagaagtggcagagagcactactccagtctgcgaaactcaacctccccgtccctcacagc
gtagccatgaatcaagtcttcttcatcagctgcaatcggcatgatcgcagtcagctctac
tgggcctatatggcagttgcagcacagtgtgagatgctgtcctggaagaatgctacggcg
gcgccgccttgtcggaggctctacgccggtgtgtcctcgttgctacgcaccgccggtacc
gccgcctcttcaggtgggccgcacggacgcacgacagacacggatgaaggaaaatggcag
gaggcggttcctctcggtgcatgcggctccgtgtacgactctcccgcggcagcggagcag
cgtcagcgataccggcggacctcgccgccgctgctgctgttggatgagactccgcctccg
cttcaccgcgacaccgaccctgagcagtgctttcgtgctgcaccacgtgacgccgtctac
tcaaccggcgttccggtggacgccttgatctggctaggggacatcatctacgccgacaag
ttcccggatggcagggacgcgcagtcgctcctgttccaccacgtcaatacaatggtaagc
atagggcgattctggcgaatccagcgcgacgctccggagtacaacgcgttcatcgacagc
tgcgtcgcaggtggcgatcatctggactggacgctgcactcaccaggggaagtgtttctg
cccgcagccgcggacaatcgcgagcgagttgtgcaactcaccccttcgccctcctccggc
actcaccgcaatgtgtgggccacctgggatgaccacgacatgggcgagaacgatggtgga
cgagagtacaccggccgtaacagcacgcagcgcttctttctgaactttttgcgagccccc
tcaagtgatccacgctggcgtcgcgagggcgtgtatggtgcatacacgaccgactttcgc
gacgtcgtggacgacgccaaggggtggggaactccaatgcggctcctgatgcagcagctt
tatgagcatgccatctgcgttgtcctcctcgacgttcgctcgttccgcgaccgcccgaac
gcgacccaggccggcgacatgctcggcgctgagcagtgggcgtggtttgaggagctcctg
cagaactacacgacactgacgcgagacgggcgagagcggtgtgcgatggtgctcataggg
ggcggcattcagttcatcctggatgagaagcccgcagaaaactgggcagccttcccccgc
tctcgggaccgcctcctcggactactgcaagcctaccgggtcgaacgcgtggccttcatc
accggcgatgtgcacatgggtgagctgggcgccgacttcaccaagcacgccattgaggag
gtgctggggtacccaatagtggaggccacgagctcggggttgacacacagtgcgaacatg
tactttctccccacattcatgccactgctcttccccagcccacggcgtctcggcctctat
gtggggacgaacttcggtgcgttgaggctctccctggacctgcgtcacctgcctttgatc
cgctcatacttgacagagatggaggcgaagatggcggcggcacgctttcggccaccacag
tggcgccgggaagtccgcgctgccgttgagcaagtcgttaatgctactttcaccatcttc
tccatcccaaaaggcggccaaccagtgtaccggctaaacttccctctctctatgctcacc
tacgcgcacggtgtagcgtatcgcgacgccacagtagatgcggtgcatgggagtgtgcac
aagaagccaacgtcatccccagcggcgccggaaaagaacggcggcaaagaggcagcgaag
gacgacacggagcgcacatcatcgtcgccgctgagggcgcttctcgtgcttaagaacggt
accattacgggcatcgcccactaccgcaacaccgagcccacaccgctcattacgtggtcg
gcgcgccagctgcagtactacattttcaccaacttctccgtctccgagacgctgaagctg
atgatcctgctcgggttctcggccggggctttggtgctcttgctgctgatgaccacgcta
tgtcggtacctgcggcggccacgaaacagctgcggcagattctattactctagcgtagca
ccctcgcctcaagtgtccctcgtgacgcggtgttcgaagaagagggtgaataaccagtgg
aacaacatagataagtag

DBGET integrated database retrieval system