KEGG   Leishmania donovani: LDBPK_181090Help
Entry
LDBPK_181090      CDS       T02289                                 

Definition
protein kinase A catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ldo  Leishmania donovani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18:452976..453974
Genome map
AA seq 332 aa AA seqDB search
MITKAEASKWRLSDLEMRETVGTGTFGRVRLVKHKGTGQYAALKILKKQEILRMKQVDHV
MAEASLLQEIDHPFIVSMLRGYMDKNRLYILLEYVVGGELFSHLRKAGKFPNDVSKFYCA
EVILAFDYLHNKTIVYRDLKPENILLDQDGNIKITDFGFAKRVTERTFTLCGTPEYLAPE
IIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKIYEKILVGKVLFPRWVDSKARDF
IKGLLSLDPTKRLGSLPNGTEDIKNHKYFAEVDWNVVLSKKIPAPIPVRQHKEGDTHYFD
KYPDSPLNSLRTLTPAQQDCFANFCNGQYTDE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaaggccgaagcttccaagtggaggctgagcgacttggagatgcgtgagacg
gtcggcaccggcactttcggccgagtacgcttggtgaagcacaaaggaacaggccagtac
gcggccctcaagatcctcaagaagcaggagattctccgaatgaagcaggtcgaccacgtg
atggcggaggcaagtcttctccaggagatcgaccacccttttattgtgagcatgctgcgg
ggatacatggacaagaaccggctgtacatactcctcgagtacgtggtaggcggcgagctg
ttctcgcatctccgcaaggccggcaagttccctaatgatgtctcgaagttctactgcgcc
gaggtgatcctagcatttgactacctgcacaacaagacgatcgtttaccgcgatctgaag
ccggagaacattctcctcgaccaagacggtaacataaagatcacggatttcggattcgcg
aagcgcgtgacggagcgtacgtttacgctttgtggcacacctgagtacctagcccccgag
atcattcagagcaaggggcacaacaaggctgtcgactggtgggcgctcggcatcctgctg
tacgaaatgctggttggctacccgccgttcttcgacgacagcccgatgaagatctacgag
aagatccttgtgggcaaggtgctcttcccgcgatgggtagactcgaaggcccgagacttc
atcaagggccttctatccctcgatcccacgaagcgccttggcagtttgcccaacggcacg
gaggacatcaagaaccacaagtactttgcggaagtggactggaatgtagtgctgtccaag
aagattcccgcgccgatcccggtacggcaacacaaggagggcgatacccactacttcgac
aagtaccccgacagcccactcaactctttgcgcactttgactccagcacagcaggactgc
ttcgcaaacttctgcaacggccagtatacggacgagtag

DBGET integrated database retrieval system