KEGG   Leishmania donovani: LDBPK_190040Help
Entry
LDBPK_190040      CDS       T02289                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ldo  Leishmania donovani
Brite
Exosome [BR:ldo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LDBPK_190040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19:complement(7132..7455)
Genome map
AA seq 107 aa AA seqDB search
MASSRKASNPHKSHRKPKRTWNVYVGRSLKAINAQMSMSHRTMKIVNSYVNDVMERICTE
AASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAVSSASR
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcccgcaaggcttccaacccgcacaagtcgcaccgcaagcctaagcgcacg
tggaacgtgtacgtgggccgctcgctgaaggcgatcaacgcccagatgtcgatgtcgcac
cgcacgatgaagatcgtgaactcgtacgtgaacgacgtgatggagcgcatctgcactgag
gccgcgtcgattgttcgcgcgaacaagaagcgcacgctgggtgcgcgcgaggtgcagacg
gcggtgcgcattgtgctgccggcggagctcgcgaagcacgccatggctgagggcacgaag
gccgtgtcgagcgcgtcccgctaa

DBGET integrated database retrieval system