KEGG   Leishmania donovani: LDBPK_191480Help
Entry
LDBPK_191480      CDS       T02289                                 

Definition
(RefSeq) mitogen-activated protein kinase
Organism
ldo  Leishmania donovani
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
19:638350..639441
Genome map
AA seq 363 aa AA seqDB search
MAQLVPLVELPSGKKIYSVRGQQFEVDRQYDLVKVVGFGACGTVCSAVANGSGERVAIKR
LSRVFGDLREGKRILREMEIMTSLKHNNLIRLHHFMRPQSKETFEDIYLVMDLYDTDLNR
IIRSRQKLTDEHLQYFMIQAFRGLHYLHSAKVMHRDLKPSNLLVNADCALAICDFGLARD
DQVMSSSDLTQYVVTRWYRPPEVLGMGSNQYTSAVDVWSLGLIFAELMLGRTLLPGTDYI
GQLVMIVNLLGSPSIDDMEFLSSEAKAFILSQPRRPALSFRDLFPMATEEATDLLSKLLV
FHPARRLTAKQVMEHPYFSKYRDAAEEADAPDPFVWNHSHIETKEQLREDLWRVVEAHSQ
SNG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactcgtccctttagttgaactgcccagcggcaaaaaaatatatagtgtccga
gggcagcagttcgaagtggacaggcaatatgatctggtcaaggttgttggatttggtgcg
tgtggcactgtttgttcagcggtcgcgaacgggtcgggtgagcgagtggcgatcaagcga
ctgtcgcgtgtttttggtgatcttcgtgaagggaaacgaattttgcgggagatggagata
atgacgtcgctgaagcacaataatctgattcgcctccaccacttcatgcggccacagtca
aaggagacttttgaggacatatacttggtgatggatctttatgacacagatctaaatcgt
attatacgaagtcggcagaaactcactgatgagcatctgcagtattttatgattcaagcg
ttccgtggattgcattaccttcactctgccaaggtgatgcatcgcgacctgaagccgagc
aacttgcttgtaaatgcagactgcgctctagcaatctgcgattttgggctggctcgtgat
gatcaagtgatgagctcgtcagatctcacacagtacgtcgtaacacggtggtacagaccc
cctgaggtactcgggatgggatccaatcagtacacgagcgcggtcgatgtctggagcctt
ggcctgatctttgcagagctaatgctggggcgcactttgcttccgggaacagattatatt
ggacagctagtaatgattgtcaacctattaggatccccgtccatagatgacatggagttt
ctgagctcagaagcaaaggcatttattctctctcagccgcgtcggccggctctctccttc
agagatctttttccaatggctacagaagaggcaactgaccttctgtcgaagctgctagtt
ttccatccagcgaggcgattaactgcgaagcaagtgatggaacatccatatttttcgaag
tacagagatgccgcagaagaagctgacgctcctgatccgtttgtgtggaatcatagccat
atagaaaccaaagagcaactccgtgaggatttgtggcgggttgtcgaagcccattcgcaa
tcgaacggatag

DBGET integrated database retrieval system