KEGG   Leishmania donovani: LDBPK_210460Help
Entry
LDBPK_210460      CDS       T02289                                 

Definition
ubiquitin hydrolase, putative
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
ldo  Leishmania donovani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21:121934..124099
Genome map
AA seq 721 aa AA seqDB search
MGNETSKSSGTASASNPLRRNSQSEAAVGFGGAPAATEKAGSPNAASTAASVPSRPIALS
AETPPLRSASGATDTVGSSVPRYVDAKSMVYTLPCFTPDRSLSSPTSGGAGPRSQPIAIQ
MAASQQLPMMSSSSDFRVGAPSSPLSPSRRHFSAANLSNTMEIPTYNTSTPTAVEDLSCS
SPVLKSYRQHSFSHSKRDACLADSPNSPDMSVHGGASLSAGASEAPVAMSLATSFSPGAG
SGSPSTAIHTKFLEITGHPLGLENYGNTCYCNSVIQLIYHCAPLRLRLLELYHVYLTKKG
KSGFEEDTVLFQLCSLIAVMHKSNNRTKDKYPREKIAPKELLNCVRAKNEVFNNDMQQDA
HEFTMFLLNDIWDTEQRIMADPANVNLFLKHETSMKKKGSLSFSWKHSKDKHISSHSHKE
NKLDKTTSAAATNSDAGANGGKAVDAQQPFSGELTPLQVILQGQFGSLTACLECENVTAR
EEVFMDLSLETAQGTSLLRCLDHFGDPEYFWGKNKLRCEECKMPVRAAKTIHVQQLPQYA
LLIHLKRFQYDVKKQIFTKKADHVALPMQMDVEEYLTDPEVVEQSLRNKLARSQKNIGVD
AVSSTSGHNNSGSGQKDEANATSSTDTFKPASEEVRRKLRGVARHKARFELTGFVAHIGE
GPNSGHYFTCVRYGPQLWRRFDDETVSTMAERDVKQYFGVPSDAVGVVTTTAYILLYERV
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgagacgtccaagtccagcggcacggcgtcggcgagcaacccacttcgccgg
aactcgcagtcggaggcggcagtgggcttcggcggtgctcccgcggcgacagaaaaggcg
ggatcgccaaatgctgcgagcaccgctgcatcggtccccagccgtcccatagcgctgtcg
gccgagacgccaccactgagatcggcgagtggggccacggacaccgtcggctcgtcagtg
ccgcgctacgtggatgcaaagagcatggtgtacacccttccctgctttaccccggatagg
tcgctgagcagcccgacgagcggcggcgctggtccacggagccaaccgatcgcaatacag
atggctgcctcacagcagctgccgatgatgtcctccagcagtgacttccgcgtgggtgcg
ccatcctcgcctctctccccatcccgccggcacttctccgctgcgaatttgtcgaacacg
atggagattccgacgtacaacacaagcacccccaccgccgtggaggacctttcctgcagc
tcaccagtgctcaaatcgtaccggcagcactccttctcccattcgaagcgggatgcgtgt
ctggccgactcccccaactccccagacatgagcgtccacggcggcgcatccctcagcgcc
ggcgcctcggaggctccggtggcgatgagcctggccacctcgttctcacctggggctggc
agcggctcgcccagcacagcgatccacacaaagttcctcgagataaccgggcacccgctg
ggcttggagaactacggcaacacttgctactgcaactccgtcatccagctgatctaccac
tgcgccccattgcggctgcggctgctcgagctgtaccacgtctacctcaccaagaagggt
aagtctggcttcgaggaggacacggtgctcttccagctctgcagcctcatcgccgttatg
cacaagtcgaacaaccgcaccaaggacaagtacccgcgcgagaagatcgccccaaaagaa
ctgctgaactgcgtgcgcgccaagaacgaggtcttcaacaacgacatgcagcaggacgca
cacgagttcaccatgtttctgctgaatgatatctgggacacggagcagcgcatcatggcc
gaccccgccaacgtaaacctctttctcaagcacgagacatccatgaagaagaaggggtcg
ttgtccttctcctggaagcacagcaaggataagcacatcagcagccacagccacaaggaa
aacaagctcgacaagacaacctcggcagcggccaccaacagcgacgccggcgcgaacggg
ggcaaggcggtggatgcacagcagcccttcagcggggagctcacccctctccaggtaatc
ctgcaaggccagttcggctccctcaccgcctgcctcgagtgcgagaacgtgaccgcccga
gaagaggtcttcatggacctcagcctcgagacggcacagggcacgtccctcctccgctgc
ctcgaccacttcggtgaccccgagtacttctgggggaagaacaagctgcgctgcgaggag
tgcaagatgccggtgcgcgccgccaagacgatccacgtgcagcagctgccgcagtacgcg
ctccttatccacctgaagcgcttccagtacgacgtgaagaagcagatcttcacaaagaag
gcggaccacgtcgcactgccgatgcagatggacgtggaggagtacctgacggacccagag
gtggtcgagcagagcctgcgcaacaagctggcgcgctcgcagaagaacatcggcgttgac
gcggtcagcagcaccagcgggcacaacaacagcggcagcggacagaaagacgaagcgaac
gcgacttcgtcgaccgacacattcaagccggcgtcggaggaggtacgccgcaagcttcgt
ggcgtcgcccgccacaaggcgcgcttcgagctgacaggttttgtcgcccacattggcgag
ggaccaaactcagggcactacttcacgtgtgtccgttacggtcctcagctgtggcgccgc
ttcgacgacgagactgtgtcgacgatggcggagcgagatgtgaagcagtactttggcgtt
ccatccgacgctgtcggcgtggtcacgacgacggcctacatactgctctacgagcgcgtt
gcgtag

DBGET integrated database retrieval system