KEGG   Leishmania donovani: LDBPK_210610Help
Entry
LDBPK_210610      CDS       T02289                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase precursorlike protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ldo  Leishmania donovani
Pathway
ldo00010  Glycolysis / Gluconeogenesis
ldo00020  Citrate cycle (TCA cycle)
ldo00620  Pyruvate metabolism
ldo01100  Metabolic pathways
ldo01110  Biosynthesis of secondary metabolites
ldo01130  Biosynthesis of antibiotics
ldo01200  Carbon metabolism
Module
ldo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBPK_210610
   00020 Citrate cycle (TCA cycle)
    LDBPK_210610
   00620 Pyruvate metabolism
    LDBPK_210610
Enzymes [BR:ldo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LDBPK_210610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl E3_binding DUF3606
Motif
Other DBs
NCBI-GeneID: 13386393
NCBI-ProteinID: XP_003860578
UniProt: E9BF46
Position
21:complement(172599..173783)
Genome map
AA seq 394 aa AA seqDB search
MMRRTLLWLVNFEPVFMPALSPSMETGTVVEWKKKVGELVKESEVFCTIQTDKAVVDYTN
TFESGYLAKIYCGNGQSAPVAKTIAVMVSDAADVSKADEYTPEGEVPAADAEAPAAAAVA
AAPAAGGASSEVPEGVTCEPVFMPALSPSMETGTVVEWKKKVGELVKESEVFCTIQTDKA
VVDYTNTFESGYLAKIYCGNGQSAPVAKTIAVMVSNAADVEKVANYYPEDAVGGPPASAA
DPSAAAAAAASARPAASAASAKHYGGSLDAAVAASGPSVARIAAGLEPSALAGIAPSGKG
GRFLKSDFSGQPGFDYNDTAPARAMQQKAAPAAAADGASKAAAKSAAPAAVSGDIYNVVL
KPGPVYKSVSDTALLKKLMCSMHIPKPKSKKAAE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggcgcacgctgctctggctcgtgaacttcgagcccgtcttcatgccggccctc
tccccgtcgatggagacaggcacggtggtcgaatggaagaagaaggttggcgagctcgtg
aaggagagcgaggtcttctgcaccatccagacggacaaggcagtagtggactacacgaac
accttcgagagcggctacctcgccaagatatactgcgggaacggccagtctgcccccgtc
gccaagacgattgctgtgatggtgagcgacgccgcggatgtcagtaaggcggacgagtac
acgcctgagggcgaggtgcctgccgcggacgcggaggcacccgccgctgctgctgttgcc
gctgcgccggccgctggtggtgcctcctctgaggtgccggaaggcgtcacctgtgagccc
gtcttcatgccggccctctccccgtcgatggagacaggcacggtggtcgaatggaagaag
aaggttggcgagctcgtgaaggagagcgaggtcttctgcaccatccagacggacaaggca
gtagtggactacacgaacaccttcgagagcggctacctcgccaagatatactgcgggaac
ggccagtctgcccccgtcgccaagacgattgctgtgatggtgagcaacgctgccgatgta
gagaaggttgccaactactaccccgaggatgcagttggcgggccgccggcctccgccgct
gacccttctgccgccgctgctgctgctgcgtcagctcgaccggctgcatcggccgcgtct
gccaagcactacggtggctcgctcgatgcggcggtggcggctagtggcccaagcgtggcc
cgcattgctgctggtctggagcccagcgctctcgccggcatcgctccctctggcaagggt
gggcgtttcctgaagtccgacttttctggtcaacccggtttcgactacaacgacaccgcg
ccggcgcgagcgatgcagcagaaggcggcccccgccgctgccgctgatggggcgagtaag
gcggctgcaaagtctgctgccccggcggcggtaagcggggacatctacaacgttgttctc
aagcccggccctgtgtacaagagcgtcagcgacacggccctgctgaagaagctcatgtgc
tccatgcacattccgaagccaaagtcgaagaaggccgccgagtaa

DBGET integrated database retrieval system