KEGG   Leishmania donovani: LDBPK_220590Help
Entry
LDBPK_220590      CDS       T02289                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase, putative
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ldo  Leishmania donovani
Pathway
ldo00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LDBPK_220590
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LDBPK_220590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 13389374
NCBI-ProteinID: XP_003860809
UniProt: E9BFS8
Position
22:complement(280039..280908)
Genome map
AA seq 289 aa AA seqDB search
MKAFIASVVGFAGASMYQSGSEVEAWGSKPAFSQEKFQPYKLIHVENESHNTKRFRFALA
SSKTRLDLPVASCITLRYTDAQGHEVMRPYTPINLVEEEGHFDLVVKCYPNSKMGSHLFS
LKVGDYIDVKGPWHTFDVKPGQYTRIGMIAGGTGLTPMFQIMNNVLNAPENKTMISLLYA
NKTEGDILLGKELDTLAKEYPGKFATYHCLTTPPKRWTGYSGHINKVIIQETMPGPDHQG
DSCVLVSGPPSFMKTICGEKDYSSYPPKQGPLEGCLKELGYSSSGVFKF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttttatcgcttcagttgtcggctttgctggagccagcatgtaccagtctggg
tccgaggtggaggcctggggcagcaagccggcattctcacaggagaagttccagccctac
aagctcatccacgtcgagaatgagtcgcacaacacaaagcgctttcgcttcgccctcgct
tcgagcaagacgcgcctggacctgcccgtggcgtcttgcatcacgctgcgctacactgac
gcccagggacacgaagtgatgcgcccctacacgcccatcaacctggtggaggaggagggc
cacttcgacctcgtagtgaaatgctacccgaattcaaagatgggctcgcaccttttttcg
ctcaaggtcggcgattacattgacgtgaagggaccgtggcacacatttgacgtgaaaccg
ggccagtacaccaggattggcatgatcgctggtggtacgggtctcacccccatgttccaa
atcatgaataacgtcctgaacgcgccggagaataagacgatgatctcgcttctctacgca
aacaagaccgaaggggacattctgctcggcaaggagctggacacgctggcgaaagagtac
cccgggaagtttgccacgtaccactgcctcacgacgccgccgaagcgctggacgggctac
tctggccacatcaacaaagtgatcatccaggagacgatgccaggcccggatcaccaaggt
gattcgtgcgttctggtgagcggcccgccgtccttcatgaagaccatctgtggcgagaag
gactacagctcctacccgcccaagcaaggcccgctcgagggctgcctaaaggagttgggc
tactcatcaagcggcgtcttcaagttctaa

DBGET integrated database retrieval system