KEGG   Leishmania donovani: LDBPK_221530Help
Entry
LDBPK_221530      CDS       T02289                                 

Definition
phosphoinositide-specific phospholipase C, putative
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ldo  Leishmania donovani
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LDBPK_221530
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LDBPK_221530
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LDBPK_221530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22:657237..659594
Genome map
AA seq 785 aa AA seqDB search
MRARGTPSHTRSVPHFFHAFLVSTLPYRPTLSIEAASTTSHRAAKHCHTIRARHSYTAPE
LCVCACVALPSSDMGVLCNTASNPEKRTATYIPALRALTDNYFATHHPNENESALFFASL
RVALRSMLHCSREEVDEFLIDSCKRSVSTSAALDKFLSNKNTSKVAPDATAAKIMQVWMM
YDKDNSGDLSYAEMKRLVEGLSFSKDLTERILKPFEDDNRHTIAFSEFAKVYSNAVSFRE
LGYVFQDLAGGGQQTISRDTFASFVCDIQGEDWDAEFLNEKLALMGCVGTDGITENNFVG
YVMSPYFDSAVEKKKLTDVYHDMDQIMCCYFISSSHNTYLTGDQLTSKSSSQMYKKALLD
GCRCVELDCWNGPHGEPIVYHGYTRTSRIAFEECVKTIRQYAFTASAYPVILSLEVHTSV
EQQDRMAEILEGGLGSLLFRPPWGSNEKPTMTFSPNNLKNKILVKAKRGDFPAREPRVDK
DDDATETDSVASTNNADYLKMKETCRKAEKDEVRVSAKLSALVSIESSKCHDVKDLSYLK
DKQPYHCSSYSERKGKAIAREAHDALVRINDTCLSRVFPAGSRIDSSNYSPLLYWASGFQ
MVAINWQSSDTFGWRLNRCFFLDNGCCGYLLKPEHLRPVTCPDVAVPENWRSLTVEVISG
FSLPSASNSEVADPFVTVFLEGPDVDSTPKSTHTIHNNGFHPVWRGAGQTEWIWTVHRWS
LSVLVLQVYDHNRCSSSQLLAEAIIPLRMLHKGFRKVSLNDSAGYSIPGSFLVCRVDYTD
APERL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcggggcactcccagccacacgcgctctgtcccgcacttcttccatgccttt
ctcgtatccaccctcccctaccggcctacactttctatcgaagcagcatccaccacttcg
caccgcgccgcaaagcactgccatacgatacgcgcgcgccattcatacacggcgcccgag
ttgtgcgtgtgcgcatgtgtggcccttccctcgtcagacatgggtgtcctctgcaacacg
gcgagcaaccctgaaaaacgcaccgccacgtacatcccggcgctcagggcgcttacggac
aactacttcgccactcaccacccgaacgaaaatgaatctgccctcttttttgcttcgctg
cgagtggcactgcgcagcatgctgcactgcagcagggaagaggtggatgagttcctaatc
gattcttgcaaacgcagcgtgagcacaagcgccgcgctcgacaagttcctgtcgaacaaa
aacacatcaaaggtggcgccagatgccacggctgccaagatcatgcaggtgtggatgatg
tacgacaaagacaatagcggcgatttgagctacgccgagatgaagcgtctggtcgagggg
ctcagcttttcgaaggacttgacagaacgaatcttgaagcccttcgaggacgacaatcgc
cacaccatcgccttttccgagtttgcgaaggtgtactcgaacgccgtgagtttcagggag
ctcggctacgtcttccaggatttggcgggggggggccagcagaccatctctcgcgacacc
ttcgccagctttgtatgcgacatccaaggcgaggactgggatgccgagtttctcaacgag
aagctcgctcttatgggctgcgtcggcaccgacggcatcacggagaataacttcgtcgga
tacgttatgagtccctacttcgactccgcggtggagaagaagaagctgacggacgtctac
cacgacatggaccagatcatgtgctgctacttcatcagctcctcacacaacacgtacctc
accggggaccagctcacgagtaaatcctcctcccagatgtacaaaaaggcgcttctcgac
gggtgccggtgcgtggagcttgattgctggaacggccctcacggcgagccgattgtgtac
cacggctacacccgcacttctcgtatagccttcgaagagtgcgttaagacgattcgccag
tacgcctttactgcttccgcataccccgtgatactctcactggaggtgcatacttcggtg
gagcagcaggatagaatggcggagattctagaaggaggactgggctcgctgctcttccgg
cctccgtggggctccaacgagaagcccaccatgaccttctcacccaacaacttaaagaac
aaaattctcgtgaaagcgaagcgcggcgacttcccggcccgcgagcctcgcgttgacaaa
gacgacgacgcaaccgagacggactcggtggcgagcacaaacaacgccgactacctgaaa
atgaaggagacttgcaggaaggccgagaaggatgaggttcgggtgtcagcgaagctgtcc
gcccttgtctccatcgagtccagcaagtgccacgacgtcaaggacttatcatacctgaag
gacaagcagccgtaccactgctcttcgtactcagagaggaaggggaaggccatcgcccgc
gaggcccacgacgcgctggtgcgcatcaacgacacgtgccttagccgcgtcttccctgcg
ggctcgcgcatcgacagcagcaactacagtccgctgctttactgggcgtctggcttccag
atggtggccatcaattggcagtccagcgataccttcggctggcgcctcaaccgctgcttt
ttcctcgacaacggctgctgcgggtacctcctgaagccagagcacctgcggcccgtgacc
tgccccgatgtggccgtcccggagaactggcggtcgctgacagtggaagtgatttcaggc
ttctcgctgccgagcgcgagcaattcagaggttgccgatccgtttgtgacagttttcctc
gagggccccgacgtggacagcacgccaaagagcacgcacacaatccataacaacggcttt
caccctgtctggcgcggagcggggcagacagagtggatatggacggtacatcggtggtcc
ctgtcggtcctcgtgctccaggtctacgaccacaacaggtgcagctcatctcagctgctc
gcagaggccatcattcctctgcgtatgcttcataaaggattccgcaaggtgtccttgaat
gactccgcgggctacagcatccccggcagctttcttgtgtgccgcgtcgactacacggat
gcaccagagcggttgtga

DBGET integrated database retrieval system