KEGG   Leishmania donovani: LDBPK_230080Help
Entry
LDBPK_230080      CDS       T02289                                 

Definition
agmatinase-like protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ldo  Leishmania donovani
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ldo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23:15094..16092
Genome map
AA seq 332 aa AA seqDB search
MFTKFLSRVKALPPRSGDWANKLGPVALMGCSGGAHMSSTKLLNHFYTSPRDCDMYAELT
FHEPGPVECPPETVIFFPVIQCGEMLDDKGEPSEASKDDWYLAMTEATTELLEKGYVPVS
VGGDGSATLAMVEAYKRLFRSSEVVLIHCSARPSLEKAEQPIRVLLEKGLLKGVVEIGNR
CVSSGDRKIRKQHKVMYMDMQAIYAKGLFCIRDIRNDYPVFLSIDADVLDPAFAPAVESP
VPGGLSTRDLLHIMTGIRGPKVAGIDIHGYHPSLDMCRSDGVGLTQMALTKVLKESIVKA
YTISTQTAEEGLERVRLMQRQGTLSDNPYPDH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccaagttcctctcacgcgtgaaggccttgccgccgagatcgggggactgggct
aacaagttgggacctgttgctctcatgggctgctcgggcggagcacacatgagttcgacg
aagcttctgaatcatttctacacgtccccgcgagactgcgacatgtatgcggagttgacc
ttccatgagcccggccctgtggaatgtccaccagagacagtcatttttttccctgtgatc
cagtgtggtgaaatgctggatgacaagggtgagcctagcgaggccagcaaggatgactgg
tatctggcgatgacagaggccacgacagagttgctggagaagggctacgtcccggtgagc
gtcggcggtgatggctccgcgacgctagctatggttgaggcgtacaagcggctcttccgg
tcaagcgaggtggtgctgattcactgctctgccagaccatcgctggagaaggcggaacag
ccgattcgggtattgctggagaagggcctgttgaagggtgttgtcgagatcggtaatcgc
tgtgtctcgtccggtgaccgcaagatccgcaagcagcacaaggtgatgtacatggatatg
caagccatatatgcaaagggtctattttgcattcgagacatccgcaatgactatccagtc
tttttgagcattgacgctgatgtattagatcccgcttttgcaccggccgtggagtcgccc
gtgccaggaggtctctctacgcgcgacctgttgcacatcatgaccggcattcgagggccc
aaggtggctggtatcgacatccatgggtaccaccctagtctggatatgtgccgtagcgat
ggcgttggcctgacccagatggcgttgacgaaggtgttgaaggagtcgattgtcaaggcg
tacaccatctccacacagactgcggaggagggtcttgagagggtgcgcctgatgcagcga
caaggcacgctgtctgacaacccatatcctgatcactga

DBGET integrated database retrieval system