KEGG   Leishmania donovani: LDBPK_240010Help
Entry
LDBPK_240010      CDS       T02289                                 

Definition
pyruvate dehydrogenase (lipoamide) kinase, putative
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     LDBPK_240010
Protein kinases [BR:ldo01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   LDBPK_240010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24:3267..4718
Genome map
AA seq 483 aa AA seqDB search
MSRPCLLLLGIDVVFAHVSGSCINHVGRADLVMLRRGFCRSIPLLGPTFTELVERLDSFE
KEFIEWKAFRKAVESTSPKVTEAAKEIIAESMKEVKTSKVNLENPLTPEEFTELNQFYAK
QKVKDIFFENLLYINTPNDLMQHSETVFRQYLVRIARRVRHLNHAPYGLSQMPGIQMLKK
WYQWSFHDVRSTPVPTTRDECYRCDRMVRRVFLRHYNVSSLITDGMVEFASREGWTHVDE
EVMRTYDELQNFFEAFCLGRVRLRFLVGNYMYLSTKILGVSKEEYAVNDPDGLTVPIFFD
HNAEDFVGQICKKCSLLVLTKCAIKEAQASYDAEIELKLAGDPNLVFVGIPYITYDIICA
MLEDAVSANVDRQERTGKACTKIEVTLAQWPTNKRFVLRISDTAGGMTLRQASKQLSCWS
LYRNIQGHNQDTISTWTSSPIRLPYAYNAARVIGGNITLASIEGYGTDRQLYLPSTGLAG
VSL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaccctgtttacttctacttggtattgacgttgtctttgctcacgtttcgggt
agctgcatcaatcacgtggggagagcagatttagtgatgcttcgtcgaggcttttgccgc
agtatcccgctcttgggacctaccttcacagagcttgtggagcggctggactcctttgag
aaggagttcatcgagtggaaggcgtttcgcaaagcggtcgagtcaacgtcgccgaaggtc
actgaagcggcgaaagagattatcgcggagagcatgaaggaggtgaagacgagcaaggtc
aacttagaaaatccgctgacgcctgaagagttcacggagttgaaccagttttacgccaag
cagaaggtgaaggatatattcttcgagaacttgctctatatcaacacaccgaatgatttg
atgcagcattcggagaccgtttttcgacagtaccttgtgcgcattgcccgccgggtacgc
cacttgaaccatgcaccctacggcctttcacaaatgccggggatccaaatgctgaagaag
tggtaccagtggagctttcacgacgttcgcagcactccagttccaacgacccgagacgaa
tgctaccggtgcgaccgcatggtgcggcgcgttttcctccgccactacaacgtgagctct
ctcatcacagatggtatggtggagtttgccagccgcgagggatggacgcatgtagacgaa
gaggtgatgcgcacatatgatgagctgcagaactttttcgaagcattttgcctgggtcgc
gtccgtcttcgctttttggtaggcaattatatgtatctttcaaccaaaatcctcggtgtc
tcgaaggaggagtacgccgtgaatgatccagacgggctcacagtgcccatttttttcgat
cataatgcggaagactttgttgggcagatctgcaagaaatgctctctgctggtgctcaca
aagtgcgcgatcaaagaagcacaggcgagttatgatgcggagatcgagctaaaactggcg
ggggatcctaatttggtctttgttgggataccgtatatcacgtacgacatcatttgcgcg
atgctcgaggacgccgtgtctgccaacgtagatcgccaggagcggacaggcaaggcgtgc
acaaaaatcgaagtcacgcttgcgcagtggccgacaaacaagcgctttgttctgcgtata
tcggatacggcgggcggaatgactttacgccaggcttcgaagcagctgtcctgctggtct
ctttacagaaacatccagggtcataatcaggatacgatttcgacgtggacctcgagtccg
attcggctaccctatgcgtataacgccgctcgcgtgattggtgggaacatcaccctggcg
tccattgaaggctacgggacggatcggcagctgtatctgccgtccacaggacttgctggt
gtgtctctgtga

DBGET integrated database retrieval system