KEGG   Leishmania donovani: LDBPK_250190Help
Entry
LDBPK_250190      CDS       T02289                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LDBPK_250190
Peptidases [BR:ldo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   LDBPK_250190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25:complement(51644..52345)
Genome map
AA seq 233 aa AA seqDB search
MWFPLESNPQVMNRYISTLGLTEAKVQFVDVYGVSDDLLEMVPSPVHAVLLVYPMCEATD
RRLAEQQAAQTAEVAALRKSHPFFFTHQLVPNACGTIAIAHALMNNRDKLGEIAAGSILD
GPWAKAAETSEDPQIIGKLIAEDTSLASAHAAAAQEGATANQHIDADIDLHFVCFIPVGG
RCVELDGRKENPILHGTCTDNRSFLTAAAAAIQERVELNPSSYEFGITALVNK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcccactggagagcaatccgcaggtgatgaaccgctacatcagcaccttgggt
ctcacagaagcgaaggtgcagtttgtggacgtgtacggtgtgtcggacgatctacttgaa
atggtgccttcgccggtgcatgccgtgctcctcgtgtaccccatgtgcgaggccacggat
agacgcctagcggagcagcaggctgcacagacagcggaagttgcggcgcttcgcaaatca
caccctttcttcttcacacaccagctcgtcccgaacgcgtgcggaaccatcgccatcgcg
catgctcttatgaacaaccgcgataagctcggtgagatcgccgccggcagcatcctcgac
ggcccgtgggcgaaggcggcagaaacgtcggaagatccccagatcatcggaaaacttatt
gcggaagacacgagtctcgccagcgctcacgccgctgctgcgcaggagggcgcgaccgcc
aaccaacacatcgacgcggacatcgaccttcactttgtctgcttcatccccgtaggcgga
cgctgcgttgagctggatgggcgaaaagagaacccgatcttgcacggtacctgcaccgac
aacaggtctttcctcaccgctgcagccgccgcgatacaggaacgcgtagagctcaacccc
agctcctacgagtttggcatcaccgcactcgtgaacaagtga

DBGET integrated database retrieval system