KEGG   Leishmania donovani: LDBPK_252210Help
Entry
LDBPK_252210      CDS       T02289                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ldo  Leishmania donovani
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LDBPK_252210
Translation factors [BR:ldo03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    LDBPK_252210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25:complement(794778..795416)
Genome map
AA seq 212 aa AA seqDB search
MDDYHEDDVHSNYGYEDDEYDDAADDWEAEAAEEEQRAVAEEAARQARLEKKLATRAPVK
KEEEEEAVPEDVERAMADMRQVANDIASGSALLSGGDSEELIGNHKLTSDADVDRVGTMI
ADRLTSFSNSAHYDKLIVEVFQRLTNHLTSTHLLNEEADRVHRLREELKRAAKAKPKPVE
KAPVTQSGLDLDNFEDRGGAAVAEENEDETGW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacgactaccacgaagatgatgtgcacagcaactacggatatgaggatgacgagtac
gacgacgccgcggatgactgggaagccgaggccgcagaggaggagcagagggccgtcgcc
gaggaggcagctcgacaagcccgtttggaaaagaagctggccacgcgtgccccggtgaag
aaggaagaggaggaggaggcagtgccagaggatgtggagcgcgcaatggcagacatgcgg
caggtggccaacgacatcgcctcgggtagtgctcttctctccggaggagattcggaggag
ctgattgggaaccataagctgacttctgacgcggatgttgaccgggtaggcaccatgatt
gcagaccgcctcacgtccttttccaactccgcccactacgacaagctaatcgtcgaagtt
tttcagcgcttgaccaaccacctgacgagcacgcatctcctgaacgaggaggcggacagg
gtacaccgtctgcgcgaggagctcaagcgcgcggcgaaggcaaagccgaagccggtagag
aaagcgcctgttacgcagagcggcctcgatctcgataacttcgaggacaggggtggcgcc
gccgttgcggaggagaacgaggacgagacgggctggtag

DBGET integrated database retrieval system