KEGG   Leishmania donovani: LDBPK_260630Help
Entry
LDBPK_260630      CDS       T02289                                 

Definition
(RefSeq) protein disulfide isomerase, putative
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ldo  Leishmania donovani
Pathway
ldo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LDBPK_260630
Enzymes [BR:ldo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LDBPK_260630
Chaperones and folding catalysts [BR:ldo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   LDBPK_260630
Membrane trafficking [BR:ldo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    LDBPK_260630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin ERp29 Thioredoxin_2 OST3_OST6 Thioredoxin_7 Thioredoxin_8 AhpC-TSA TraF HyaE Redoxin Thioredoxin_6 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 13388897
NCBI-ProteinID: XP_003861651
UniProt: E9BI76
Position
26:complement(180999..182132)
Genome map
AA seq 377 aa AA seqDB search
MNRRLSVVLALALVVFVLAGSCSSEDPGAVMPGIVQMSKDNFDQLVGKDKAALVEFYAPW
CGHCKSMAPEYAALGAAYEASTNAKDLLLIGKVDATEDSDLGKRFGVTGFPTILYFASGS
LEPEKYKGGRTAEDFAKYLSSAVAGLRLTIPNEPQFAMELVHTNFDAVVKDPSKAVLVMF
YAPWCGHCKALKPIYNKLAKVFSNDKDVVIARINADDAANRKIATEYAVSGFPTLYFFPK
GADEKPVEYKNGRNLEDFLTFVNENAGKHRLANGDLSWEYGVIAELAEAVARVATSSGES
SKAAVEAVKAVASTLTESEDAAYYIKAAERIAAKGPAYVESESARLKRTLGGPVAGDRRD
NMVMRLNILTSIQKHMK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccggcttagtgttgtgctggcgctcgcgctcgtggtcttcgtgctcgcgggg
tcgtgcagcagcgaagacccgggtgctgtgatgccgggtatcgtgcagatgagtaaggac
aacttcgaccagctcgtgggcaaggacaaggcggcattggtggagttttacgcgccgtgg
tgtggccactgcaagagcatggcccccgagtacgcggctctgggcgcggcctacgaagcg
agcacgaacgctaaggacctgctgttaattggcaaggtggacgccacagaggacagcgac
ctcggcaagcgcttcggcgtcacggggttcccgacaattctgtacttcgcttctggctca
ttggagccggagaagtacaagggcggccgcacggccgaggactttgccaagtacctctcg
agtgcggtggcgggcctgaggctgaccatcccgaatgagccacagtttgcgatggagctg
gtgcacacgaattttgatgcagtcgtcaaggacccgtcgaaggcggtgctcgttatgttc
tacgccccgtggtgcggccactgcaaggcgctgaagccgatttacaacaagcttgccaag
gtgttctcaaacgataaggatgttgtgatcgcccgcatcaacgctgacgatgccgccaac
cggaaaattgcaaccgagtacgctgtttccggctttccgacgctgtacttctttcccaaa
ggcgccgatgagaagccggtcgagtacaagaatggccgcaacctggaggacttcctcacc
ttcgtgaacgagaacgccggcaagcaccgcctcgctaacggagacctctcatgggagtac
ggcgtcatcgcagagctcgcggaggcggtcgcgcgtgtggcgacgagctccggcgagagc
tccaaggcagcagtagaggcggtgaaggcggtcgcttccacgctgactgagagcgaggac
gccgcgtactacatcaaggcagcggaacgcattgcggcgaagggccccgcgtacgtggag
agtgaatcggctcgcctcaagcgcaccctcggaggccctgtggcgggcgatcgccgtgat
aacatggtgatgcgcctgaatattctgacctcgatccagaagcacatgaagtag

DBGET integrated database retrieval system