KEGG   Leishmania donovani: LDBPK_262740Help
Entry
LDBPK_262740      CDS       T02289                                 

Definition
(RefSeq) glutamate 5-kinase, putative
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ldo  Leishmania donovani
Pathway
ldo00330  Arginine and proline metabolism
ldo00332  Carbapenem biosynthesis
ldo01100  Metabolic pathways
ldo01130  Biosynthesis of antibiotics
ldo01230  Biosynthesis of amino acids
Module
ldo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LDBPK_262740
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LDBPK_262740
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LDBPK_262740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-GeneID: 13389106
NCBI-ProteinID: XP_003861858
UniProt: E9BIT5
Position
26:1055222..1056013
Genome map
AA seq 263 aa AA seqDB search
MADILKSVKRIVVKVGSSILVDNQEIAAHRIEALCQFIADLQTKYEVILVTSGAVAAGYT
KKEMDKSYVPNKQALASMGQPLLMHMYYTELQKHGILCAQMLLAAYDLDSRKRTINAHNT
IEVLISHKVIPIINENDATALDELVFGDNDRLSALVAHHFKADLLVILSDIDGYYTENPR
TSTNATIRSVVHELSPDDLVAEATPNNRFATGGIVTKLQAAQFLLERGGKMYLSSGFHLE
KARQFLLGGSHEIGTLFYSRVSS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcttgaagtcggtgaagcgcatcgtggtaaaggtgggctcctcgatcctt
gtggacaatcaggagatcgccgcgcaccggatcgaggcgctatgccagtttatcgccgac
cttcagaccaagtacgaagtgatccttgtcacatccggcgcagtcgccgcggggtacacg
aaaaaagagatggataagtcatatgtgccgaataagcaggcactcgcgtcgatggggcag
ccactgctcatgcacatgtactacaccgagctgcaaaagcacggcatcctgtgcgctcag
atgctgcttgctgcctatgatctcgactcgcggaagcgtactatcaacgcccataatacc
attgaggtgctcatcagccacaaggtgatcccgatcatcaacgaaaacgatgcgacggcg
cttgacgagctggtctttggcgacaatgaccgtctgtccgcgctagttgcgcaccacttc
aaggccgacctacttgtcattctcagcgacatcgacggctactacaccgaaaatccacgc
acttccacgaatgccacgatacgctctgtcgtccacgaacttagccctgacgatcttgta
gcagaggccaccccgaacaatcggttcgcgacgggtgggattgtgacgaagctgcaggct
gctcaattcctcctggaaaggggaggaaaaatgtacctctcgagcggattccacctagag
aaggcacgccagttccttctcggcggctcgcacgagatcggcacactgttttattcgaga
gtttcatcttga

DBGET integrated database retrieval system