KEGG   Leishmania donovani: LDBPK_262740Help
Entry
LDBPK_262740      CDS       T02289                                 

Definition
glutamate 5-kinase, putative
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ldo  Leishmania donovani
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LDBPK_262740
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LDBPK_262740
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LDBPK_262740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26:1055222..1056013
Genome map
AA seq 263 aa AA seqDB search
MADILKSVKRIVVKVGSSILVDNQEIAAHRIEALCQFIADLQTKYEVILVTSGAVAAGYT
KKEMDKSYVPNKQALASMGQPLLMHMYYTELQKHGILCAQMLLAAYDLDSRKRTINAHNT
IEVLISHKVIPIINENDATALDELVFGDNDRLSALVAHHFKADLLVILSDIDGYYTENPR
TSTNATIRSVVHELSPDDLVAEATPNNRFATGGIVTKLQAAQFLLERGGKMYLSSGFHLE
KARQFLLGGSHEIGTLFYSRVSS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcttgaagtcggtgaagcgcatcgtggtaaaggtgggctcctcgatcctt
gtggacaatcaggagatcgccgcgcaccggatcgaggcgctatgccagtttatcgccgac
cttcagaccaagtacgaagtgatccttgtcacatccggcgcagtcgccgcggggtacacg
aaaaaagagatggataagtcatatgtgccgaataagcaggcactcgcgtcgatggggcag
ccactgctcatgcacatgtactacaccgagctgcaaaagcacggcatcctgtgcgctcag
atgctgcttgctgcctatgatctcgactcgcggaagcgtactatcaacgcccataatacc
attgaggtgctcatcagccacaaggtgatcccgatcatcaacgaaaacgatgcgacggcg
cttgacgagctggtctttggcgacaatgaccgtctgtccgcgctagttgcgcaccacttc
aaggccgacctacttgtcattctcagcgacatcgacggctactacaccgaaaatccacgc
acttccacgaatgccacgatacgctctgtcgtccacgaacttagccctgacgatcttgta
gcagaggccaccccgaacaatcggttcgcgacgggtgggattgtgacgaagctgcaggct
gctcaattcctcctggaaaggggaggaaaaatgtacctctcgagcggattccacctagag
aaggcacgccagttccttctcggcggctcgcacgagatcggcacactgttttattcgaga
gtttcatcttga

DBGET integrated database retrieval system