KEGG   Leishmania donovani: LDBPK_271520Help
Entry
LDBPK_271520      CDS       T02289                                 

Definition
eukaryotic translation initiation factor eIF-4E, putative
Orthology
K03259  
translation initiation factor 4E
Organism
ldo  Leishmania donovani
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LDBPK_271520
Translation factors [BR:ldo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    LDBPK_271520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27:591692..592333
Genome map
AA seq 213 aa AA seqDB search
MSAPSSVPPHKMANLHKLQRAWTLWYDSPSTYNTENWEMSLVPIMTVHSVEEFFVMLRYM
KPLHALRTSSQYHFFQEGVKPMWEDPANKKGGKLWVNLDITSANGRSSNNTSGTAAADGS
AAEAKTDLDKAWENVLMATVGEYLDCVEKKDTSAEPFVTGIVMSKRKYHNRLAVWVSDAS
ATGKIEALKKALTKEASLAPIASIVFTKHGEAS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccccatcttcagttcctccccacaaaatggcgaatttgcacaagctgcagcgt
gcctggacactctggtacgatagcccgtctacgtacaacactgaaaactgggagatgtcg
ttggtgcccatcatgaccgtgcactccgtggaggagttcttcgtcatgctcaggtacatg
aagcctctgcatgccttgcgcacctcctcgcagtaccacttcttccaggaaggcgttaag
ccgatgtgggaggacccggcgaacaagaagggcggcaagctctgggtaaaccttgatatc
accagcgccaatggtcggagcagcaacaacaccagcggcaccgcggcagccgacggcagc
gcggcggaggccaagacggacctcgacaaggcgtgggaaaatgttctgatggccaccgtg
ggcgagtatctcgactgtgtagaaaagaaggacacatcagcggagccgttcgtgacgggc
attgtcatgtcaaagcgaaagtaccacaaccgcctcgccgtgtgggtgagcgatgcgtcc
gcaacgggcaagatcgaggcgctaaagaaggcgctaacaaaggaggcgagtctggcgccg
atcgcatccattgtcttcacaaaacacggcgaggcgtcttag

DBGET integrated database retrieval system