KEGG   Leishmania donovani: LDBPK_281350Help
Entry
LDBPK_281350      CDS       T02289                                 

Definition
p450 reductase, putative
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LDBPK_281350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:475832..477769
Genome map
AA seq 645 aa AA seqDB search
MSFLYIVATVLFALAGYFYFQLNRQASGRYGAVSATTNSNGKKVPGVSDAAASGSNAVAK
DQQEVTVLFGSQTGTAEMFAKTLTREGTKLGVPIKVCDLDCYEAYNMECERLVILICATY
GEGEPTDTMKNFHDWMMDECRSPGEELANVKYAVFGLGDRQYKYFCEEGIVMDSRFEELG
AQRIFGLGCGDSGNGQLEEQFDEWCKDLWPAVGRALNITIKENSEEPVEPQCRVKYWEEA
EEPLAFPKTASVLEPTQRLPVWVPIIRNEELLRNAEGRSTRAIDFSISDTIISYQAGDHL
GILPCNPDELVSQYLQSLGISDEEAGRVFSLQDKKTLKNVLPARVSMRTALKWYIDLTGP
PKKSTLRAFAHCCTDPVQKEELLRILRVNQDAQKEFAKLCGKLRTMLGFLRKFNSAKVPL
SFFLELMPRIAPRYYSISSDLLATPTLVGTTVGIVDGGLCTNMLARMQVGDKVPVFVRKS
NFHLPMRHKERPVVMIGAGTGVAPFIGFIARRGVWKQKGTELGKSILFFGCRRHDEDHIF
EDYCTEALHEGVLSALVTAYSRDQAHKVYVQHRLRERGAEIWEMLVSGANVYICGDARRM
AKDVEAELKRIVEVEGKMPREAATEYMNVMEKEGRYLKDVWSSTL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcctctacattgtcgccacggtgctgttcgccctggcgggctatttctacttc
cagctgaaccggcaggcttccggacgctatggcgctgtgtctgccaccaccaattccaat
ggcaagaaggtgcctggcgtgagcgacgccgctgccagcggcagtaacgcagttgcgaag
gatcagcaggaggtcactgtcctgtttggatcgcagacgggcacggccgagatgtttgcc
aagacgctgacccgcgagggtacgaagctcggcgtgcctatcaaggtgtgcgacctcgac
tgctacgaggcgtacaacatggagtgcgagcgcctggtcattctaatctgcgccacctac
ggcgagggtgagccgaccgacacaatgaagaacttccacgactggatgatggacgagtgc
cgctcgccaggggaggagctggcgaatgtcaagtacgcggtgttcggcctgggtgatcgt
cagtacaagtacttctgcgaggagggtatcgtcatggatagccgcttcgaggagctcggg
gcgcagcgcatctttggccttggctgcggcgactcgggcaacggacagctggaggagcag
ttcgatgagtggtgcaaggacctctggcccgctgtcgggcgtgcgctgaacatcactatc
aaggagaactcggaagaacccgtggagccacagtgccgagtcaagtactgggaggaggcc
gaggaaccgctcgcgttccccaaaacggcttccgtgctggagccgacgcaacgcctgccg
gtgtgggtgcccatcatccgcaacgaagagctgctgcgcaatgccgaggggcgcagcacc
cgcgccatcgatttcagcatcagcgacaccatcatctcctaccaagccggcgatcacctc
ggcatcctgccgtgcaacccggacgagcttgtctcgcagtacctgcagtccctcggcatc
tcagacgaggaggccggccgcgtcttttccctgcaggacaaaaagaccctcaagaacgtc
ctcccagctcgtgtgtcgatgcgcacggcgctcaagtggtacatcgacctcaccgggccc
ccgaagaaatcgacgttgcgtgcctttgctcattgctgcaccgaccccgtccagaaagag
gagctgctgcgcattctacgcgtgaaccaggacgcacagaaggagttcgcgaaactatgc
ggtaagctgcgcaccatgctaggcttcctgcgcaagttcaactctgccaaggtgccgctg
tcctttttcctcgagctcatgccgcgcatcgcgccccgctactactctatctcctccgac
ctccttgccacgccgaccttggtggggacgacggtcggcattgtcgatggtggactgtgc
acgaacatgcttgccaggatgcaggtgggcgacaaggtgcccgtgtttgtgcgtaagtcc
aacttccacctcccgatgcggcacaaggagcggccggtggtaatgattggcgccggcacc
ggtgtggcgccattcattggtttcattgcacgccgtggggtctggaagcagaaaggtact
gaactcggcaagtctatcctcttctttggctgccgccggcatgacgaggatcacatcttc
gaggactactgcacggaggcactccacgaaggggtcctgtcggcgctggtgaccgcgtac
agtcgcgaccaagcccacaaggtgtatgtccagcaccggctgagggagcggggggcggag
atatgggaaatgttggtatctggcgcgaacgtctacatctgcggtgacgcgaggcgcatg
gccaaggacgtggaggcggagctcaagcgcattgtggaggtggagggcaagatgccgcgc
gaggctgctaccgagtacatgaacgtgatggaaaaggaggggcggtacctaaaggatgtg
tggtcatcgaccttgtag

DBGET integrated database retrieval system