KEGG   Leishmania donovani: LDBPK_282600Help
Entry
LDBPK_282600      CDS       T02289                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase, putative
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ldo  Leishmania donovani
Pathway
ldo00020  Citrate cycle (TCA cycle)
ldo00310  Lysine degradation
ldo01100  Metabolic pathways
ldo01110  Biosynthesis of secondary metabolites
ldo01130  Biosynthesis of antibiotics
ldo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LDBPK_282600
  Amino acid metabolism
   00310 Lysine degradation
    LDBPK_282600
Enzymes [BR:ldo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LDBPK_282600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-GeneID: 13387094
NCBI-ProteinID: XP_003862358
UniProt: E9BJY0
Position
28:961518..962687
Genome map
AA seq 389 aa AA seqDB search
MFRRVPTRVLPTACSAAHNVSLRFCLSIKVPTIAESISTGKVVNWAKKVGDAVAEDEVIC
QIESDKLNVDVRAPANGVITKINFEEGADVEVGAELSTMKEGPAPAATAPKAAEVKLDAP
KAEPPKAAAPAAAAPAAPAAPVVAAKPAMHTMAGADPRTKSVRISSMRRRIADRLKASQN
TCAMLTTFNEIDMTPLFQLRDKYKDEFHKRHDVKLGLMSPFVKASAIALKDVPIVNASFG
KDTIDYHEFVDIAIAVATPRGLVVPVIRDVQNMNLANIETAIADYAARARINKLTMAEMT
GGTFTISNGGVFGSWMGTPIINPPHSAILGMHAIKKKPWVVGNEIKIRDIMAVALTYDHR
LIDGSDAVTFLVKVKNLIEDPARMVLDLS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcgtgtgccgacgcgcgtgttgcccactgcgtgcagtgcggcccacaacgtg
agcctccgcttctgcctcagcatcaaagtacccacaattgccgagtccatcagtacgggt
aaggttgtgaactgggcgaagaaggtcggcgacgccgtcgccgaagacgaagtaatttgc
cagatcgagtcggacaagctcaacgtcgacgtgcgtgcgccggcgaacggcgtcattacg
aagatcaatttcgaggagggcgctgatgtcgaggtcggcgcggaactgtccacgatgaag
gagggccccgcgccagcggcaactgcaccgaaggctgcggaagtcaagttggacgcaccc
aaggcggagccgccgaaggctgcagccccagctgctgcggcgcctgcggctcctgccgca
cctgtcgtcgccgccaagcccgcgatgcacaccatggccggcgctgacccgcgcacgaag
agcgtccgcatctcctcgatgcgccgccgcatcgctgaccgcctcaaggccagccagaac
acgtgcgccatgctgaccaccttcaatgagatcgacatgacaccgctgttccagctgcgc
gacaagtacaaggacgagttccacaagcgccacgacgtgaagctgggactgatgtcgccc
ttcgtgaaggcgagcgcgattgcgctcaaggatgtgccgatcgtgaacgcatcctttggc
aaggacaccattgactaccacgagttcgtagatatcgcgatcgccgtggcgacgccgcgc
ggcctcgtcgtgcccgtaatccgtgatgtgcagaacatgaacttggcaaacatcgagacc
gccatcgccgactacgccgcgcgtgcgcgcatcaacaagctgaccatggctgagatgact
ggaggcaccttcaccatctccaacggcggcgtcttcggatcttggatgggcacgccgatc
atcaaccctccgcatagcgccatccttggcatgcacgccatcaagaaaaaaccgtgggtg
gtgggcaacgagatcaagatccgcgacatcatggcggtcgctctgacctacgaccaccgc
cttatcgacggtagcgacgcggtgaccttcctcgtgaaggtgaagaatctgattgaggac
ccggcgcgtatggtgctggacctctcgtag

DBGET integrated database retrieval system