KEGG   Leishmania donovani: LDBPK_292140Help
Entry
LDBPK_292140      CDS       T02289                                 

Definition
serine/threonine protein kinase, putative
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ldo  Leishmania donovani
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:ldo04140]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:complement(903676..906123)
Genome map
AA seq 815 aa AA seqDB search
MAQAAYPPSREGSYPHSRSGGPRANPMLPEQMIGSYVIRETIGRGSFGKVKKGRHVHTGE
YVAIKILNRQKLKSANMDKKIHREIEILQLFSHPNICRLYEVISTPTDMYLIMEYVEGGE
LYDYIVQKGRVRESEARYIFQQIVCAIEYCHHFRVVHRDLKPENILLGTGLQVKLIDFGL
SNITKDGEFLATSCGSPNYAAPEVISGKLYFGPEVDVWSCGVILYALLCGCLPFDEDSIP
LLFSKIKKGKYAIPSNMQTGPRELIQQILVVDPLVRLTVPQIRDNAWFNQRLPMRLSYSE
SIFSVKEDRILSVLVSETAKRLGVRDRDVRKELELGYGAAFVAYNILLDARRRREIAAEV
RELGMSGDESRGVSHVIGAQQTKFQPKATERELNMGLMLTQSPAMVVLLDEEDATRNKWA
YNRGCFVPASVATLGDPTKVSDTSLSDGSGNGGPGGSIAVGSFRITSKMCSGSLVGSGSV
GSSSYAPGSLRGAAGLTGGSSSYRRAGMQSSTGGTAASQLGANLSDQPRVGSVARKHAMY
TAEEEQFIVENNYGWRIGIMTDWRAEQALSAIYDVLRTFKMQWKVVSPFRLLARSTAETW
SVMADSTQSRNASTRRNTLSTYSVESSAPIRIGCRSGAPGSGSSDDHEDGDIAGSMQRDE
ECIHAHITRTRRAGAAARSFGSAPGGGFNTSSSQVARGNYFGGLQGGDEEAAIVSGSAAS
GVLQSAHAIESGSESTSSPRDPRGASPPASAAASTSAIAEPASSPANPVVISLYFFRIHE
RHDKGYLVDFKVVRNAMVAADLVLLLSDTLVRKLG
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggccgcgtacccaccgtcacgagagggcagctacccacactctcgtagcggt
ggtccccgcgcgaacccgatgctgcccgagcagatgatcggcagctacgtcattcgcgag
accatcggccgcggtagctttggcaaggtgaagaaagggcgacacgtgcacactggagag
tatgtcgccatcaagatcctcaaccgccaaaaactcaagtccgccaacatggacaagaag
attcaccgcgagatcgaaattctgcagctgttctctcacccgaacatctgccgtctctac
gaggtcatctccacacctacggacatgtaccttattatggagtacgtggaaggcggagag
ctgtacgactacattgtccagaagggccgcgtgcgggaaagtgaggcgcgttacatcttc
cagcagattgtgtgcgcgatcgagtactgccaccacttccgcgtcgtgcatcgtgaccta
aagccagagaacattctgctgggaactgggctgcaggtaaagctgatcgactttggtctt
tcgaacatcacgaaggatggcgagttcctcgcgacgtcgtgcgggtcgcccaactacgcc
gcaccggaggtcatttcaggtaaactgtactttggtccagaggtggatgtatggtcttgt
ggcgtcattctctacgcgctgctctgcgggtgcctgccgttcgacgaggatagcatcccg
ctccttttcagcaagatcaagaagggcaagtatgccatcccatccaacatgcagacgggg
ccgcgggagctcattcagcagatcctcgtcgtggacccactcgtgcggctcaccgtcccg
caaatccgcgacaacgcctggttcaatcaacgcctgccaatgcggctgtcttacagtgag
tccatcttcagcgtgaaggaagaccgcattttatcggtgttggtgagcgaaacagcgaag
cggctgggagtgcgggacagagatgtgcgcaaggagctcgagctcggctacggggccgcc
tttgtcgcctataatattctgttggacgcacgccgccgtcgcgagattgcggctgaagtg
cgcgagcttggcatgtccggcgatgagtcccgcggggtgagccacgtcatcggcgcccag
cagacgaagtttcagccaaaggcgacagagcgggagctcaacatgggcctcatgctgacg
cagagccccgcgatggtggtgctgcttgacgaagaagacgccacgaggaacaagtgggcc
tacaaccgcggctgcttcgtgcccgcttccgtcgcaacccttggcgacccaacaaaggtg
agcgatacgagcctgagcgatggcagcggcaatggcggtccaggcgggtcgatcgcagtc
ggctccttccgtatcacttccaagatgtgctccggatccctggtcggctccggcagcgta
ggctcttcctcttatgcgccaggcagtctgcgcggcgcggcggggctcacgggcggcagc
agcagctaccggcgtgctggcatgcagagcagcacagggggaaccgccgcctcgcagctg
ggggcgaacctgagcgaccagccgcgcgtcggatctgtagcccgcaagcacgccatgtac
accgcggaggaggagcagttcattgtggagaacaactacggctggcgcatcggtatcatg
acggactggcgggcagagcaggcgctttccgccatctatgacgtcctgcgtaccttcaag
atgcagtggaaggtggtctcgcccttccgcctcttggcacggtcaacagccgagacatgg
agtgtgatggcggactcgacgcagagccgcaacgcgtccacacgccgaaacacgctaagc
acttactccgttgaatcctctgcaccgatccggattggctgccgcagcggtgccccaggg
agcggcagcagtgacgatcacgaggacggagacatcgccggtagcatgcaacgcgacgag
gagtgcatccacgcacatataacccgcacacgccgggcaggcgctgcggctcgcagcttc
gggagcgcaccaggtggcggcttcaacactagctcgagccaggtcgcgcgcggcaactat
ttcggcggcctacagggcggagacgaggaagcggcgatagtctctggaagcgcggcgtcg
ggagtgctgcagtcagcacatgcgattgagagcgggtctgagtcgacgtcctcgccgcgt
gacccacgcggcgcgtccccaccagcgagcgccgctgcctccacctccgcaattgcggaa
ccagcctcgtcaccggcaaatcctgtcgttatttccctctacttctttcgcattcacgag
cggcacgataaaggttacctggtggatttcaaggtcgtgcgcaatgccatggtcgccgcg
gacctggtgcttctcctctctgatacgctggtcaggaagttgggctaa

DBGET integrated database retrieval system