KEGG   Leishmania donovani: LDBPK_292410Help
Entry
LDBPK_292410      CDS       T02289                                 

Definition
ubiquitin hydrolase, putative
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LDBPK_292410
Peptidases [BR:ldo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LDBPK_292410
Exosome [BR:ldo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LDBPK_292410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:complement(1046009..1048255)
Genome map
AA seq 748 aa AA seqDB search
MPFPVTQEACPHAWSDSAIVTPFPGKTVHRDECAYCCRTCRQGDGVYVCMACHTGLCCEH
LEKHMRVHGAHAMYTTVKKLPAKETDEVKDVNYLGVVAPAEYETAVCCADCQVRFAQVPD
LAVEAYSGIINAPEPGAQDSAADGGVGRLQKPQCPHLVCLEQLASPFAVCPPTSDDICSV
EMCGCNVNNWMCVTCGAIGCPRPEAGGQGHALQHYELTGHPACVKLGTITAEGADYYCYA
CDDDVDDVHFAAHMAHFGIDVQTAKKTAKTMGELEYDYSSQFDFNKITEAGVSLTPSYGP
GHTGIENIGNSCYLASVVQCLMSLGPFQRFFFPAKSTPHQAQCTANPYNCHHCQTERVAA
GLLSGEFSREGHELTNGICPRLFKKVYAHQHPEFSTGAQQDAQEYLLYLLEEMQRHVQLN
SSGSTSADNVQQQIHPSDIMEMVIEQRMQCSKCQRVRYTYETDKCLSLPIPIDPVPASSV
AAAASEAEMDAIRPRCSLEDCLQAATSPSGIECRCEACLESAVYYTVTRLASFPDVLPVY
IRRTYFDMTTHNTKKMDAYVEVPQKLVLEAYRGTGLQPGEVLMPASSASSARQPRLDAHV
AAPQQEVDEVALVSVVSMGIEMDVARYALLQTNMNVERAIDYIFSHPHIADEIKAAPPLH
AEEQEQHLAPTQSATSVSAPKPATDGAASYELTAMISHMGASARTGHYVCHIKDAATGKW
LLFNDEKVGESQNPPFSLASLYFFQRQA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgccgttccctgtgacgcaggaggcgtgtcctcacgcgtggagtgactctgccatagtg
accccgttccccggaaagacagtgcaccgtgacgagtgtgcgtactgctgccggacatgc
cgtcaaggcgacggagtctatgtatgtatggcatgccacacaggtctgtgctgcgagcac
ctggagaagcacatgagggtgcacggggcgcacgccatgtacacaaccgtcaagaagctc
cccgcaaaggaaacggatgaggtgaaggatgtgaattaccttggtgtagtggcccccgcg
gagtatgagacggcggtgtgctgcgcggattgccaggtgcggtttgcgcaagtaccggac
ctggctgtcgaggcgtacagcggcatcatcaacgcgccggaaccaggcgcgcaggatagc
gcagctgatggcggtgtgggccgcctgcagaagccgcaatgccctcatctggtgtgcctc
gaacagctggcgagcccctttgctgtttgtccgcccacttccgacgacatctgctccgtg
gagatgtgcggatgcaacgtgaacaactggatgtgcgtcacgtgcggtgcaatcggttgc
cctcgtcccgaagcaggcggccagggccatgcactacagcactatgagctgacaggacac
cctgcgtgtgtcaagcttggcaccatcaccgcggagggcgccgactactattgctacgcc
tgcgacgatgacgttgatgacgtacacttcgcagcccacatggcacactttggcattgac
gtacaaactgccaagaagactgccaagacgatgggcgagctcgagtacgactactcctcg
cagtttgacttcaacaagatcacggaggcgggcgtgtccttgacgccatcctacggtcca
ggccacactggcatcgagaatattggcaacagctgctacctcgcatccgttgtgcagtgc
cttatgtcgctgggcccgttccagcgcttcttctttccggccaagtcgaccccgcatcag
gcacagtgcaccgcgaatccgtacaactgccaccactgccagacggagcgcgtggcggcc
ggcttgctctccggtgagttcagccgggaaggccacgagctcaccaacggcatctgcccc
cgcctcttcaagaaggtgtacgcccaccagcaccctgagttctccactggcgcccagcag
gatgctcaggagtacctgctctacctgctggaagagatgcagcggcacgtgcaactcaac
agcagcggcagcaccagtgccgacaatgtgcagcagcagattcacccgtctgatatcatg
gagatggtgattgagcagcgtatgcagtgcagcaagtgccagcgagtgcgctacacgtat
gagacggacaaatgcctgtccttgccgatcccgatcgatccggtgccggcctcgtctgtt
gcagctgctgcaagcgaggcggagatggacgcgatacggcctcggtgctcgctggaggac
tgcctgcaagcagccacctcgccgagcggcatcgagtgccggtgcgaggcatgccttgaa
tcggccgtgtactacaccgtcacccgcctcgccagcttcccagatgttctgccagtgtac
attcgccgcacgtacttcgacatgactacccacaacacaaagaaaatggatgcatatgtg
gaggtgccgcagaagctcgttctggaggcttaccgcggcactgggctgcagccgggtgag
gtgctgatgcctgcttcgtcggcctcctctgcacgacagcctaggctagatgcccacgtg
gccgctccgcagcaggaagtagatgaggtggcactggtgtcggtggttagcatggggatc
gagatggacgtcgcgcgctacgccctcttacagacgaacatgaacgttgagcgcgccatc
gactacatattcagccatccgcacatcgctgacgagatcaaggccgcgccaccgctgcac
gccgaggagcaggagcagcatttggcgccaacccaaagcgctacttcagtgagcgctcca
aaaccggctaccgatggggccgcctcatacgagctcacagcgatgatcagtcacatgggc
gcgagtgcacggacggggcattacgtttgccacatcaaggatgccgcgacgggcaagtgg
ctcctattcaatgatgaaaaggtgggtgagtcgcagaacccgcccttctccctggcgtcg
ctgtactttttccaacgccaggcgtaa

DBGET integrated database retrieval system