KEGG   Leishmania donovani: LDBPK_292420Help
Entry
LDBPK_292420      CDS       T02289                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase-like protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ldo  Leishmania donovani
Pathway
ldo00062  Fatty acid elongation
ldo00071  Fatty acid degradation
ldo00280  Valine, leucine and isoleucine degradation
ldo00310  Lysine degradation
ldo00380  Tryptophan metabolism
ldo00410  beta-Alanine metabolism
ldo00640  Propanoate metabolism
ldo00650  Butanoate metabolism
ldo01100  Metabolic pathways
ldo01110  Biosynthesis of secondary metabolites
ldo01130  Biosynthesis of antibiotics
ldo01200  Carbon metabolism
ldo01212  Fatty acid metabolism
Module
ldo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LDBPK_292420
   00650 Butanoate metabolism
    LDBPK_292420
  Lipid metabolism
   00062 Fatty acid elongation
    LDBPK_292420
   00071 Fatty acid degradation
    LDBPK_292420
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LDBPK_292420
   00310 Lysine degradation
    LDBPK_292420
   00380 Tryptophan metabolism
    LDBPK_292420
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LDBPK_292420
Enzymes [BR:ldo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LDBPK_292420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 13385363
NCBI-ProteinID: XP_003862660
UniProt: E9BL39
Position
29:complement(1051194..1051997)
Genome map
AA seq 267 aa AA seqDB search
MFRYSHLIRCAAQPVVKACQVGPVVTLTINRPTQLNALNRAVSESLMENLEKYDKDPSCS
AFIITGEGRAFVAGADIKSMKDRTFSEGVLSNDFQALTRIRTIGKPIIAAVNGFALGGGC
ELAMSCDIIVASEEAKFGQPEIKLATIPGLGGTQRLTRMIGKARAMEWVLLGNTYTAAEA
ERAGIVSRVVKHEELMPTAMFMAEKIASYSQIAVKLAKMAVNESQETLLAAGLAYESMVF
NSTFSTHDRKEGMTAFVEKRAPQFQNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgttccgctactcccacctgattcgctgcgccgcgcagcctgtggtaaaggcgtgccag
gtcggccctgtggttacgttaactatcaaccgccccacccagcttaatgccctcaacagg
gccgtgtcggagagcctcatggaaaacttggaaaagtacgacaaggacccctcgtgctcc
gcgttcatcatcacaggcgagggtcgcgcattcgtcgcgggggctgatattaagtctatg
aaggatcgcaccttttccgagggcgtcctgtcaaacgacttccaagcattgacccgcatc
cgtaccatcggcaagccgatcattgcggcggtcaatggtttcgctctcggcggtgggtgt
gagctggccatgtcctgcgacatcattgtcgcaagcgaagaggcgaagtttggacagcct
gagattaagctggcgaccattccaggactgggcggcacgcagcgtctgacgcgcatgatt
ggcaaggctcgtgcgatggagtgggttctcttgggcaacacgtacacggcggcggaagcg
gagcgcgcggggattgtgtcgcgcgtggtgaaacacgaggagctgatgccgacggccatg
ttcatggcggagaagattgcaagctacagccagattgccgtgaagctggccaaaatggct
gtaaacgagtcgcaggagacgttgctcgcggctggtttggcgtacgagtctatggttttc
aactccaccttctctactcacgacagaaaggagggcatgaccgcgtttgtggagaagcgc
gcacctcagtttcaaaacaagtga

DBGET integrated database retrieval system