KEGG   Leishmania donovani: LDBPK_292620Help
Entry
LDBPK_292620      CDS       T02289                                 

Definition
(RefSeq) ATP-dependent phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ldo  Leishmania donovani
Pathway
ldo00010  Glycolysis / Gluconeogenesis
ldo00030  Pentose phosphate pathway
ldo00051  Fructose and mannose metabolism
ldo00052  Galactose metabolism
ldo01100  Metabolic pathways
ldo01110  Biosynthesis of secondary metabolites
ldo01130  Biosynthesis of antibiotics
ldo01200  Carbon metabolism
ldo01230  Biosynthesis of amino acids
ldo03018  RNA degradation
Module
ldo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LDBPK_292620
   00030 Pentose phosphate pathway
    LDBPK_292620
   00051 Fructose and mannose metabolism
    LDBPK_292620
   00052 Galactose metabolism
    LDBPK_292620
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LDBPK_292620
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LDBPK_292620
Protein phosphatases and associated proteins [BR:ldo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LDBPK_292620
Messenger RNA biogenesis [BR:ldo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LDBPK_292620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 13385383
NCBI-ProteinID: XP_003862680
UniProt: E9BL59
Position
29:1117343..1118803
Genome map
AA seq 486 aa AA seqDB search
METRHHLNTKMVPSYQAPLSKVTAADLTVERLPGCKYMNPSKKHILREEYRDKVEHIMYD
PRPQEDLDAEYPVSCNKLVCELAAARKHLHFNPSETSIGIVTCGGICPGLNDVIRSITLT
GIISYRVKRVVGFRYGYWGLSKEGSKTAIELSRSDVRQIHRFGGTILGSSRGPQNPKEMV
DTLVRMKINILFTVGGDGTQRGALTIYEEAKRRGENIAVFGVPKTIDNDLAFSHRTFGFQ
TAVEQAVNAVRAAYAEAVSLNYGVGIVKLMGRESGFIAAQTTVASAQANICLIPENPLPK
ETVMRLIERRLQQSRNCVIVVAEGFGQDWETGTGGHDASGNKKLVDIGFILKKEVESWLR
ANKEKFPQGTVKYIDPSYMIRACPPSSNDALFCTNLATLAVHEAMAGATGCIISMRYNNY
ILVPIKAATSVRRVVSLRGALWRQVREITVGLSDDVQQWNEQDLRRHLESLNVERERIIA
RLASKV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggagactcgccaccatctcaacaccaagatggtgccgtcgtaccaggcaccgctgtcc
aaggtgaccgccgccgacctgacggtggagcgcctgcccggctgcaagtacatgaacccc
tcaaagaagcacattctccgtgaggagtaccgcgacaaggtggagcacatcatgtacgac
cctcgcccgcaggaggacctggacgccgagtacccggtgtcgtgcaacaagctggtgtgc
gaactggctgccgcccgcaagcacctccacttcaacccttccgagacctccatcggtatt
gtaacctgcggcggcatctgccctggtctgaacgacgtcatccgctccatcacgctgacg
ggcatcatatcctaccgcgtcaagcgcgttgtcggtttccgttacggctactggggcctg
tcgaaggagggcagcaagactgccatagagctgtcccgctcggatgtgcgccagattcac
cgcttcggtggcacgatcctgggtagctctcgcggtccgcagaacccgaaggagatggtc
gacacgcttgtgcgcatgaagatcaacatcctcttcaccgttggtggtgatggcacgcag
cgcggtgcgctaacgatctacgaggaggccaagcgccggggcgagaacatcgccgtcttc
ggtgtgcccaagacgatcgataacgaccttgccttctcccaccgcacctttggctttcag
actgccgtcgagcaagctgtgaacgccgtgcgcgccgcctacgccgaggctgtgtccctc
aactacggtgtcggcatcgtgaagctgatgggtcgtgagagcggcttcattgctgcccag
acgactgtggccagcgcgcaggcgaacatctgcctcattcctgagaacccgttgccaaag
gagacggtgatgcgcctgattgagcgccgccttcagcagtcgcgcaactgcgtcatcgtg
gttgccgagggcttcggccaggactgggagaccggcacgggcggccatgacgcctccggt
aacaagaagctcgtcgacattggcttcatcctgaagaaggaggtggagagctggctgcga
gcaaacaaggagaagttcccgcagggtactgtcaaatatatcgacccctcgtacatgatc
cgcgcctgcccgccgtcttccaacgacgcgctcttctgcaccaacctggcaactcttgcc
gtgcacgaggccatggccggtgccaccggctgcatcatctcaatgcgctacaacaactat
atcctcgtgcccatcaaggcggccacgtcggtgcgccgggtcgttagtctccgtggcgcc
ctctggcgccaggtgcgtgagatcaccgtgggcctgagcgacgatgtgcagcagtggaac
gagcaggacctgcgccgccacctggagtcgctgaatgttgagcgtgagcgcataattgcg
cgcctggcgtctaaggtgtaa

DBGET integrated database retrieval system