KEGG   Leishmania donovani: LDBPK_300370Help
Entry
LDBPK_300370      CDS       T02289                                 

Definition
mitogen-activated protein kinase, putative
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LDBPK_300370
Protein kinases [BR:ldo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LDBPK_300370
Exosome [BR:ldo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LDBPK_300370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30:complement(120649..121881)
Genome map
AA seq 410 aa AA seqDB search
MILTKVEGPNAAGNKVYVFGVNDYRLEVPERYNVQHFVGRGAYGFVCSAVDAVTNEPVAI
KKVTHLFDDAVDAKRVLREVKLLAYLKHPNILSLKDLFKSPDPVDTYSELYVVTDLMESD
MDAILRSPRIRLAAGHGQYFTLQLLCALQYIHSAHVLHRDLKPGNLLTDSECNLKLGDFG
LARGIGHDDTMTQYVFTRWYRPPELLLVCKHCNYSADMWAVGCLAAEMFTGKPLFPGKDY
INQINLIVELLGIPDLARDLPPSTSTEAIHYLSSLPPSKGKKLEEYAPELRRRFDETTFY
DSFDTELEEAIAAEGATIARPQPRPPEEYYAEFVDFIFGLLRYNPEKRRTAKESIAHAWL
SDVRGPQETIGGCEAERIYRWDADGTAFTIPQLRHLFIDEIGKFASTRGS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatactcaccaaggtagagggccctaacgcggctggcaacaaggtttacgtctttggc
gtgaacgactaccgccttgaggtcccagagcgctacaacgttcagcactttgtggggcgt
ggcgcttacggctttgtgtgcagcgccgtggacgcggtgacgaacgagccggtggcgatt
aagaaggtgacgcacctcttcgacgatgccgtcgatgcaaagcgcgtcttgcgggaggtg
aagctgttagcctatctcaagcaccccaacatcctctccctcaaggatctcttcaagtca
ccggacccggtcgacacgtacagcgagctctacgttgtgaccgacttgatggagtcggac
atggacgccatcctgcgctccccacgcatccgtctcgccgccgggcacgggcagtacttc
acccttcagctgctgtgcgcactgcaatacattcacagcgctcatgtgctgcaccgagac
ctgaagccggggaacctgctgacagactcggagtgcaaccttaagctgggcgacttcggc
ctcgcgcggggtatcgggcatgacgacaccatgacacagtatgtgttcacgcggtggtac
cggccaccagagttgctgctggtgtgcaagcactgcaactacagcgcggacatgtgggct
gttggatgccttgcggcagagatgttcaccggcaagccgctcttccctggcaaagactac
atcaaccagatcaatctcatagtggagttgctgggcataccggacctggcacgtgacctg
ccgccgagcacgtcaacggaggcgatacactacctctcctccctgccccctagcaagggg
aagaagctcgaggagtacgccccggagctgcggcgtcgctttgacgagaccaccttttat
gacagcttcgacacggagctagaggaggcgattgctgcggagggcgccaccatcgcccgc
cctcagccacgcccgccggaggagtactacgccgagttcgtcgacttcatctttggacta
cttcgttacaaccccgagaagcggcgcacagcgaaggagtccatagcgcatgcgtggctg
tcggacgtgcgcggcccacaggagaccattggcggctgcgaggcggagcgaatataccgc
tgggatgccgacggcaccgccttcaccatcccacaacttcgccatctctttatagatgag
atcggaaagtttgcgtctacccggggcagctga

DBGET integrated database retrieval system