KEGG   Leishmania donovani: LDBPK_300370Help
Entry
LDBPK_300370      CDS       T02289                                 

Definition
(RefSeq) mitogen-activated protein kinase, putative
Organism
ldo  Leishmania donovani
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
30:complement(120649..121881)
Genome map
AA seq 410 aa AA seqDB search
MILTKVEGPNAAGNKVYVFGVNDYRLEVPERYNVQHFVGRGAYGFVCSAVDAVTNEPVAI
KKVTHLFDDAVDAKRVLREVKLLAYLKHPNILSLKDLFKSPDPVDTYSELYVVTDLMESD
MDAILRSPRIRLAAGHGQYFTLQLLCALQYIHSAHVLHRDLKPGNLLTDSECNLKLGDFG
LARGIGHDDTMTQYVFTRWYRPPELLLVCKHCNYSADMWAVGCLAAEMFTGKPLFPGKDY
INQINLIVELLGIPDLARDLPPSTSTEAIHYLSSLPPSKGKKLEEYAPELRRRFDETTFY
DSFDTELEEAIAAEGATIARPQPRPPEEYYAEFVDFIFGLLRYNPEKRRTAKESIAHAWL
SDVRGPQETIGGCEAERIYRWDADGTAFTIPQLRHLFIDEIGKFASTRGS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatactcaccaaggtagagggccctaacgcggctggcaacaaggtttacgtctttggc
gtgaacgactaccgccttgaggtcccagagcgctacaacgttcagcactttgtggggcgt
ggcgcttacggctttgtgtgcagcgccgtggacgcggtgacgaacgagccggtggcgatt
aagaaggtgacgcacctcttcgacgatgccgtcgatgcaaagcgcgtcttgcgggaggtg
aagctgttagcctatctcaagcaccccaacatcctctccctcaaggatctcttcaagtca
ccggacccggtcgacacgtacagcgagctctacgttgtgaccgacttgatggagtcggac
atggacgccatcctgcgctccccacgcatccgtctcgccgccgggcacgggcagtacttc
acccttcagctgctgtgcgcactgcaatacattcacagcgctcatgtgctgcaccgagac
ctgaagccggggaacctgctgacagactcggagtgcaaccttaagctgggcgacttcggc
ctcgcgcggggtatcgggcatgacgacaccatgacacagtatgtgttcacgcggtggtac
cggccaccagagttgctgctggtgtgcaagcactgcaactacagcgcggacatgtgggct
gttggatgccttgcggcagagatgttcaccggcaagccgctcttccctggcaaagactac
atcaaccagatcaatctcatagtggagttgctgggcataccggacctggcacgtgacctg
ccgccgagcacgtcaacggaggcgatacactacctctcctccctgccccctagcaagggg
aagaagctcgaggagtacgccccggagctgcggcgtcgctttgacgagaccaccttttat
gacagcttcgacacggagctagaggaggcgattgctgcggagggcgccaccatcgcccgc
cctcagccacgcccgccggaggagtactacgccgagttcgtcgacttcatctttggacta
cttcgttacaaccccgagaagcggcgcacagcgaaggagtccatagcgcatgcgtggctg
tcggacgtgcgcggcccacaggagaccattggcggctgcgaggcggagcgaatataccgc
tgggatgccgacggcaccgccttcaccatcccacaacttcgccatctctttatagatgag
atcggaaagtttgcgtctacccggggcagctga

DBGET integrated database retrieval system