KEGG   Leishmania donovani: LDBPK_310150Help
Entry
LDBPK_310150      CDS       T02289                                 

Definition
ubiquitin hydrolase, putative
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LDBPK_310150
Peptidases [BR:ldo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LDBPK_310150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31:complement(35661..37037)
Genome map
AA seq 458 aa AA seqDB search
MAEIKVKWGKENLTMEVDLGSTVGAFKEALKAKTGVPVEKQKLMGLKPSMNKDDATLSAA
GLVTGKTVMLIGSAESTAAVPTVQAAVVEANETGGYTATATTSNGLKNIANTCYLNSALQ
MMRSIPEIREVLEAYRGDNALLQQLAAVLQLLESTKDAVMPLQFWTTLVQTNPTFGERNE
HGGFMQQDSQEVLNMLLQAVNSVLPKKYAHLFEGKLHQTLTCVDDPADKGKESDVPFTML
SCNITGEVQTLEAGLEHAFDERFTAPCEALQKDVAQFTRVSKLTEAPEYVFVHMVRFSWR
GDIQKKAKILKPITFPFILDTTIISTEALKAAQKPVREGIRERRDKELERRRRPRTEEKP
SPVDKPQEEEKVPLALKNESGYYDLCGVISHKGRSADGGHYVYWGKKADKWLVYDDEHVA
AVSEEDVKRLRGVGEAHIAYVLLYRSRDPVTRTPVIPL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaagtcaagtggggtaaggagaacctcacgatggaggtcgacctggga
agtacggtgggtgccttcaaggaggccctcaaagccaagaccggggtgccagtggagaag
cagaagctcatgggcctaaagccctccatgaacaaggatgacgctacgctcagcgccgcc
ggcctcgtgacaggcaagacggtgatgctgattgggtcagcggagagcactgcagcggtg
cccacggtgcaagcggctgttgtagaagcaaatgagacaggtggctacaccgcgactgcg
acaacttcaaatggcttaaagaatattgccaacacgtgctacctgaactcggctctgcag
atgatgcggagtattccggagattcgggaagtgctcgaggcgtaccgcggcgacaacgca
cttctgcagcagcttgctgccgttctacagttgctggagagcaccaaggatgctgtgatg
ccgctacagttctggacgacgctcgtgcagacaaatccaacgtttggtgagcgcaacgag
cacggcggcttcatgcagcaggactcgcaggaggtgctgaacatgctgctccaggccgta
aactccgtgctgcccaagaagtacgcgcacctcttcgaaggcaagctgcatcagactctc
acctgcgtcgacgacccggctgacaagggcaaggagtccgacgtgcccttcacgatgctc
tcctgcaatatcactggagaggtgcagacgctcgaggcggggctcgagcacgccttcgac
gagcgcttcaccgcaccttgcgaggccctgcagaaagacgtcgcccagttcactcgcgtt
agcaaactgaccgaagcaccggaatatgtctttgtgcacatggtgcgcttctcctggcgc
ggcgacattcaaaagaaggcgaagatcctcaagcctatcacgttccccttcattctcgac
accaccatcatctccaccgaagcgctcaaggcggcacagaagccggtgcgcgagggtatc
cgcgagcggcgcgacaaggagctggagcggcgccgccgcccccgcacagaggagaagccg
tcgccagtggacaaaccgcaggaggaggagaaggtgcccctggccctcaagaatgagagc
ggctactatgacctgtgcggcgtcatctcgcacaagggccgcagcgcggacggcggccac
tacgtctactggggtaagaaagcagacaagtggctcgtctacgacgacgagcacgtggcg
gccgtctcggaggaggacgtgaagcggctgcgtggtgtcggagaagctcacatcgcctac
gtcctgctgtatcgcagtcgcgaccccgtcacacgaactccggttattccactttag

DBGET integrated database retrieval system