KEGG   Leishmania donovani: LDBPK_310150Help
Entry
LDBPK_310150      CDS       T02289                                 

Definition
ubiquitin hydrolase, putative
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ldo  Leishmania donovani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31:complement(35661..37037)
Genome map
AA seq 458 aa AA seqDB search
MAEIKVKWGKENLTMEVDLGSTVGAFKEALKAKTGVPVEKQKLMGLKPSMNKDDATLSAA
GLVTGKTVMLIGSAESTAAVPTVQAAVVEANETGGYTATATTSNGLKNIANTCYLNSALQ
MMRSIPEIREVLEAYRGDNALLQQLAAVLQLLESTKDAVMPLQFWTTLVQTNPTFGERNE
HGGFMQQDSQEVLNMLLQAVNSVLPKKYAHLFEGKLHQTLTCVDDPADKGKESDVPFTML
SCNITGEVQTLEAGLEHAFDERFTAPCEALQKDVAQFTRVSKLTEAPEYVFVHMVRFSWR
GDIQKKAKILKPITFPFILDTTIISTEALKAAQKPVREGIRERRDKELERRRRPRTEEKP
SPVDKPQEEEKVPLALKNESGYYDLCGVISHKGRSADGGHYVYWGKKADKWLVYDDEHVA
AVSEEDVKRLRGVGEAHIAYVLLYRSRDPVTRTPVIPL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaagtcaagtggggtaaggagaacctcacgatggaggtcgacctggga
agtacggtgggtgccttcaaggaggccctcaaagccaagaccggggtgccagtggagaag
cagaagctcatgggcctaaagccctccatgaacaaggatgacgctacgctcagcgccgcc
ggcctcgtgacaggcaagacggtgatgctgattgggtcagcggagagcactgcagcggtg
cccacggtgcaagcggctgttgtagaagcaaatgagacaggtggctacaccgcgactgcg
acaacttcaaatggcttaaagaatattgccaacacgtgctacctgaactcggctctgcag
atgatgcggagtattccggagattcgggaagtgctcgaggcgtaccgcggcgacaacgca
cttctgcagcagcttgctgccgttctacagttgctggagagcaccaaggatgctgtgatg
ccgctacagttctggacgacgctcgtgcagacaaatccaacgtttggtgagcgcaacgag
cacggcggcttcatgcagcaggactcgcaggaggtgctgaacatgctgctccaggccgta
aactccgtgctgcccaagaagtacgcgcacctcttcgaaggcaagctgcatcagactctc
acctgcgtcgacgacccggctgacaagggcaaggagtccgacgtgcccttcacgatgctc
tcctgcaatatcactggagaggtgcagacgctcgaggcggggctcgagcacgccttcgac
gagcgcttcaccgcaccttgcgaggccctgcagaaagacgtcgcccagttcactcgcgtt
agcaaactgaccgaagcaccggaatatgtctttgtgcacatggtgcgcttctcctggcgc
ggcgacattcaaaagaaggcgaagatcctcaagcctatcacgttccccttcattctcgac
accaccatcatctccaccgaagcgctcaaggcggcacagaagccggtgcgcgagggtatc
cgcgagcggcgcgacaaggagctggagcggcgccgccgcccccgcacagaggagaagccg
tcgccagtggacaaaccgcaggaggaggagaaggtgcccctggccctcaagaatgagagc
ggctactatgacctgtgcggcgtcatctcgcacaagggccgcagcgcggacggcggccac
tacgtctactggggtaagaaagcagacaagtggctcgtctacgacgacgagcacgtggcg
gccgtctcggaggaggacgtgaagcggctgcgtggtgtcggagaagctcacatcgcctac
gtcctgctgtatcgcagtcgcgaccccgtcacacgaactccggttattccactttag

DBGET integrated database retrieval system