KEGG   Leishmania donovani: LDBPK_313080Help
Entry
LDBPK_313080      CDS       T02289                                 

Definition
(RefSeq) acetyl-CoA carboxylase, putative
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
ldo  Leishmania donovani
Pathway
ldo00061  Fatty acid biosynthesis
ldo00620  Pyruvate metabolism
ldo00640  Propanoate metabolism
ldo01100  Metabolic pathways
ldo01110  Biosynthesis of secondary metabolites
ldo01130  Biosynthesis of antibiotics
ldo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LDBPK_313080
   00640 Propanoate metabolism
    LDBPK_313080
  Lipid metabolism
   00061 Fatty acid biosynthesis
    LDBPK_313080
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    LDBPK_313080
Enzymes [BR:ldo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     LDBPK_313080
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     LDBPK_313080
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LDBPK_313080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans ACC_central CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 13389964
NCBI-ProteinID: XP_003863393
UniProt: E9BN78
Position
31:complement(1410245..1416751)
Genome map
AA seq 2168 aa AA seqDB search
MEAMQEKSSPVGFRYDSMEQLCSSLGAIMPIKRLLIANNGLAAVKGMDSIRSWMYEHTGD
SDAVQFVVMATPEDLKANAEFISLADKHIPVPGGMNSNNYANVDVIMQTALQNMCDAIYP
GWGHASENPALPRECMKSKRVTFLGPSEDAMFALGDKIASTIVAQSNGVPTVPWSGDSIR
LPPKTFSVDAAAYEKAYVNSPEECEEVCRRIGFPVMIKASEGGGGKGIRSCKCLKDVKSL
FFAVSEEVKGCHIFVMRMLENVRHLEVQLLADCYGNCIAVRTRDCSVQRRHQKIIEEGPA
FGVDPAIITAMERAAIQLACAVKYCGLGTVEYMYDKETHKFYFLELNPRIQVEHPVSEMI
SGVNLPAALFCVGMGIPLDRIPEVRAFYGEDPYGTTPIDFSARQSVPPKCHTIAVRVTAE
DTDEGFRPTSGKVEEIAFKNSKECWGYFSVGSGGEIHQYADSQFGHIFSSGETREDARRG
MVLALRKLVVRGEIRTSTSYAMELLETSAFRDCDVSTAWLDGMIAKKAAEAPAHQRSIHS
ALIAASIYRNMRWMQEHKDKYIAFLAAGHVPSTEYLSNLHTESYVSRSEKYTLSAGMVSL
NEYAISLNGSIVLVPYRILTSGALQLTIGDKTLVAYVAEEPNSLRITIGGKVTNFSGDVD
PTKIMASVPGRLVRYVIDDDGHVNEGDAFAELEVMKMILPLRARTTGTLHHRAVPGTTIA
MGSLLAEITPDDPSKVARPKEIQDPWPTELLVARQYERPDGVTRARRAAESLWLLVNGFH
FKEIPIEERVRRAFADLASLGLSSVTLKAVHLPFIPAEICDETEARPQTPSEKYRAIIDT
IVDRYVTVEQPFDGHSRQEAIEGLRNTLDDNEAVFQIDFAHNQECHHYVMRSVLKYLESN
ALLLKSLKGTLSKLVTLKSFAYGSLLLQARYLLRMCSLPSFTERKAQFAEALEEGSLRSL
VASGFGYDLLCSIMFDRQMEHLVHICLELFIRREYSGESEIKDLDILKQGTSWYASYNFD
PIEDAEVLHMSDELAVGSRRIIGGRGICVMLPDEKLLQSTLASSFRDVVSHYSDDIVIAT
VFFSVSRESTQSDVARMCRLLMEENAAVFQKFEKLETVYFMAHGMPEGPHFFTFRAETGF
QEDTLLRNVLPQSARRLELDRLSNYEVSMHPTPYKDVHVFKAAPKKAGASALEHRMFARV
AVTPHDMGMTPWTEVTDVDVGHMLAKCLAALQVARDDSTVKFPDSNHVFVKMIELTFDVR
SLQPLLVAAASSYQEKLTELGVRDVEVSFHVKVPSGLIPMRVIAKSPSGYGVSVHVYYES
LSNGQLQLHRAETSEDVDYSSTGRSAESLLEMSLTSPMMPAPRGTPHLMRTASKLGDLRE
MLPSEKEQQISVDMMSEPTETRHRAITLGPYPQLEARDVKRLQARRAGTTYVHDWPAVLN
LILRKEWMKLRCALDLPHTSIPKNPLRATELFLCEDGELLSTRRTFAQSCGMVVWMVEYA
PPRYFDMELKTAQTRRIVVVANDITFQSGSFAVPEDCVFKAASVLARAQHVPFVYISTNS
GARLGLSTEVKKRFLVEFTEKNDIAYLYLTKSDYEELRERKKIQMEAEPLEVKGETRYVI
KGVVGGPTEYIGVENLSGSGLVAGEMSKNYSEIPTISLVSGRSVGIGAYLNRLGRRVIQT
NDSPLILTGAGALNRLLGKDVYMGNSQLGGKQIMVPNGVTHWCTHHDYGSARVLLRWLDY
VPAVLHPRRCTPHRLLWASVDPIDRDVTFCPTSNTQYDPRLLVTGLLGQTGLFDRGSWME
TLEGWARTVVVGRATLGGIPCGVILVETRLTKKFDPADPADPTSTSSFITQAGQVWFPDS
ARKTADALDDFHHERLPCFILANWRGFSGGMRDMFDEVLKFGASIVDNLRVYTAPVFIYI
PPGGELRGGAWVVVDPTINHNGVVEMYCDPSSRGGILEPSGVVEIKFRDDDVLQLIRRSR
PDLAAMEAKAAREAEKELLPHYRDVAVRFADLHDTYVRMKATGVVRDVVPWKDSRRHFYH
KLQRKLKELEVANDMLEVGVVDSLAGGVRKVEECYSVAHPNGPAWGTADQDQLKWLQGLD
GTWVGESNGHAALNNSEWAKELQRLLTLHGGEESSMERALAKLFENPAIAKAAKVALDSS
ACAHSTAE
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgatgcaggaaaagagttccccggtggggttccggtacgactccatggagcag
ctgtgtagctcgctcggggctataatgccgatcaagcgccttcttattgccaacaacgga
ctcgccgccgtgaaggggatggactcgattcgatcgtggatgtacgagcacacgggtgac
tccgatgcggttcagttcgtggtgatggccaccccagaggacctaaaggcgaacgccgaa
ttcatctcgctcgcggacaagcatattcctgttccgggcggcatgaatagcaacaactac
gcaaacgtggatgtcattatgcagacagcgctgcagaacatgtgtgacgccatctacccc
ggctggggccacgcctccgagaacccggcactgccgcgcgagtgcatgaagtcaaaacgc
gtcacctttcttggcccgtctgaagatgccatgtttgcgttgggagacaagatcgcctca
acgattgtggcgcagtccaacggtgtaccgacggttccgtggagcggcgacagcattcgc
ctccccccaaagaccttctctgtggacgccgcagcgtacgagaaggcgtacgtgaactcg
ccggaggagtgcgaggaggtgtgccgccgcatcggcttccccgtgatgatcaaggcgtct
gaaggcggtggtggcaagggtatccgcagctgcaagtgtctgaaggacgtcaagagcttg
ttcttcgctgtgtccgaggaggtgaaaggctgccacatctttgtgatgcgcatgctggag
aatgtgcgtcacctggaggtgcagctgcttgccgactgctacggcaactgcatcgccgtg
cgcacgcgtgactgcagcgtgcagcggcgccaccaaaagattatcgaggagggccccgcc
ttcggggtcgatcccgccatcatcacggcaatggaaagagcggccattcagctggcctgc
gcggtgaaatactgcggtctcggcacggtggagtacatgtacgacaaggagacgcacaag
ttttactttttggagctgaacccgcgcatccaggtcgaacaccccgtctcggagatgatc
tcgggcgtgaatctgccggctgccctcttctgcgtcggcatgggcatcccgctcgaccgc
attccggaggtgcgcgccttctacggcgaggacccgtacggcaccaccccgatcgacttc
tcggcccgccagagcgtaccgccgaagtgccatacgatcgctgtgcgcgtgacggccgag
gatacggacgaaggcttccggccgacctccggcaaggtggaggagattgccttcaagaac
agcaaggagtgctggggctacttctccgtcggctccggcggtgagattcaccagtacgcc
gactcgcagtttggccacatcttttcctccggcgagacccgcgaggatgcgcgccgcggg
atggtgcttgcgctccgcaaacttgtcgtccgcggcgaaatccgcacgtcgacgtcgtac
gccatggagctgctagagacgtcggccttccgcgactgtgatgtgagcacggcttggctg
gacggcatgatcgccaagaaagcggccgaagcgccggcgcaccagcgcagcatccactcc
gcgctgatcgccgccagcatctaccgcaacatgcgctggatgcaggaacacaaggacaag
tacatcgccttcctcgccgccggccacgtgccgtccacggagtatctctccaaccttcac
accgagtcctacgtgagccgctcggagaagtacacgctgagcgccggtatggtgagcctg
aacgagtacgccatctccttgaacggcagtatcgtgctggtgccgtaccgcatcctcacg
tccggtgccctgcaactgaccatcggcgacaagacgctggtcgcctacgtcgccgaggag
ccgaacagcctgcgcatcaccatcggcggcaaagtgacgaacttctccggcgacgttgac
ccgacgaaaattatggccagcgtccccggccgcctggtgcgctacgtcatcgacgatgac
ggccacgtcaacgagggcgacgcgtttgccgagttggaggtaatgaagatgattctgccg
ctgcgggccaggactaccggtacgttgcatcaccgtgccgtgcccggcacgaccatcgcg
atgggctcgctgctggccgagatcaccccggacgacccgagcaaggtcgcgcgaccgaag
gagatccaagacccgtggccgacagagctgcttgtcgcccgtcagtacgagcggccagac
ggcgtgacgcgcgcgcgccgcgccgcggagtcgctgtggttgcttgtcaacggcttccat
ttcaaggagattccgatcgaggagcgggtgcgcagggcattcgccgacctcgcctcgctg
ggtctctcgtcggtcacgctcaaggcggtccacctgcccttcattcctgccgagatatgc
gacgagacggaggcgcgcccgcagacgccgagcgagaagtaccgcgccatcatcgacacc
attgtggaccgctacgtcaccgtggagcagccctttgacgggcacagccggcaagaggcg
atcgaggggctgcgcaacaccctcgacgacaacgaggccgtcttccagatagactttgcg
cacaaccaggaatgccaccactacgtaatgcgcagcgtgctgaaatacctcgagagcaac
gcgctgcttctcaagtctctgaaagggacgctgtcgaagttggtcaccctcaagtccttc
gcgtatggctcgctgctgttgcaggcgcgctacctgctccgcatgtgctccttgccgtcc
ttcacggagcgcaaggcgcagttcgcggaggccctggaggagggcagcctgcgtagcctc
gtcgccagcggtttcggctacgacctcctctgctccatcatgttcgaccgtcagatggag
cacctagtgcacatatgcctcgagctgttcattcgccgtgagtactctggcgagagcgag
atcaaggatctggacattttgaagcagggcaccagctggtacgccagctacaacttcgac
cccatcgaggatgcggaggtgctgcacatgagcgacgagctggctgtggggtcgcgaaga
ataatcggtgggcggggcatctgcgtcatgctgcccgatgagaagctgctccagtcgacg
ctggcctcgtcgttccgcgatgttgtgtcacactacagcgacgacatcgtcatcgcaacc
gtcttcttctccgtctcgcgcgagtcgacgcagtcagacgtggcgcgcatgtgtcgcctg
ctgatggaggagaacgcggccgtctttcagaagttcgaaaagctcgagacggtgtacttc
atggcacatgggatgccggaggggccgcatttcttcacgttccgggcggagacgggcttc
caggaggacacactgctgcgcaacgtgctgccacagtcggcgcgtcggctggaactcgac
cggctgtcgaactacgaggtgagcatgcacccgacaccctacaaggatgtacacgtgttc
aaggcggcccccaagaaggctggcgcgtccgcgctggagcaccgcatgttcgcgcgtgtg
gcggtgacgcctcacgacatgggcatgactccctggacggaggtgacggacgtggatgtg
ggccacatgctggctaagtgcctggcagcgctgcaggtagcccgcgacgactcgacggtg
aagtttccggacagcaatcacgtgttcgtaaagatgattgagctgaccttcgacgtccgc
tcgctgcagcccctgctggtggcggcggccagctcgtaccaggagaagctgacggagttg
ggtgtgcgggatgtggaagtatcctttcacgtgaaggtgccgtcgggtctcattccaatg
cgtgtcatcgccaagagcccgtctggctatggcgtgtcggtgcatgtctactacgagtca
ctgtcgaacggccagctgcagctgcaccgtgccgagacgtctgaggacgtcgactactcg
tccacgggccgctccgccgagtccctgctggagatgagcctcacctcccctatgatgccg
gcgccgcgcgggacgccgcatctgatgcgcaccgcgtcgaagctgggggacctgcgcgag
atgctgccgtccgaaaaagagcagcaaatttccgtcgatatgatgtcggagccgacggag
acgcgccaccgcgccatcactctcgggccgtacccacagcttgaagcgcgtgacgtgaag
cgcctgcaggcacgccgcgccggcacgacgtacgtgcacgactggccggccgtgctgaac
cttatcctacgtaaggagtggatgaagctgcgctgcgcgctggatctgcctcacacctcc
atcccaaagaacccgctgcgcgccacggagctctttctttgcgaggacggggaattgctg
tcgacgagaaggaccttcgcgcagtcgtgtggcatggtggtgtggatggtcgagtacgcg
ccgccgcgctacttcgatatggagttgaagacggcgcagacgcgccgcatcgtggtcgtc
gccaatgacatcacctttcagtccggatccttcgccgtcccggaggactgcgtcttcaag
gccgcctcggtgcttgcccgcgcgcagcacgtgccgtttgtgtacattagcaccaacagc
ggcgcacgtcttggcctcagcaccgaggtcaagaagaggttcctcgtcgagttcacggag
aagaatgatatagcctacctgtacctcaccaagagcgactacgaggagctgagggaacgg
aagaagattcagatggaggcggaaccgcttgaggtgaaaggagaaacgcggtacgtgata
aaaggcgtggtgggcgggccgacggagtacatcggcgttgaaaacctgagcgggtccggt
ctcgtggcgggtgagatgtcgaagaactacagcgagatcccgaccatcagcctcgtctcg
gggcgcagtgtcggcatcggcgcttacctgaaccgtcttggccgccgcgtcatccagacg
aacgactcgcctctcatcctgactggcgccggtgctctcaaccgactgctcggcaaggac
gtgtacatgggcaacagccagctcggcggcaagcagattatggtgccgaacggtgtcacg
cactggtgcacacaccacgactatggctctgcccgcgtgctgctgcggtggctcgactac
gtgccggctgtcctgcaccctcggcgctgcacaccgcatcgcctgctctgggcctctgtc
gacccgatcgatcgcgacgtgaccttctgcccgacgtcgaacacgcagtacgacccacgc
ctcctcgtgacgggactgctcggtcagacgggcctgttcgaccgcggctcgtggatggag
acgctggaggggtgggcacgtacggtggtggtcggccgcgccacgctcggcggcatcccc
tgcggcgttatccttgttgagacgcgcctgacgaagaagttcgacccggcagatccggct
gacccgacctcgacgtcttcttttattacgcaggcgggccaggtgtggtttcccgactcg
gcgcgcaagacggccgacgccctcgatgacttccaccatgaacggctgccatgcttcatc
ctggcgaactggcgcggcttctcgggtggcatgcgcgacatgtttgacgaggtgctgaag
tttggcgcctccatcgtcgacaacctccgcgtctacactgcgccggtcttcatctacatt
ccgccagggggcgagctgcgaggtggggcctgggtggtcgtggacccgacgatcaaccac
aacggcgtcgtcgagatgtactgcgacccgtcctcgcgcggtggcatccttgagccgtct
ggtgtggtggagatcaagtttcgcgacgacgacgtgctgcagctgattcggcgcagtcgg
ccggacctcgcagcgatggaggcgaaggcggcccgtgaggccgagaaagagctgctgccg
cattaccgcgacgttgcggtgcgcttcgccgatctgcatgacacgtacgtgcggatgaaa
gcgaccggtgtggtgcgcgacgtcgtcccgtggaaagatagccgccgccacttctaccac
aagctgcaacgcaaactgaaggagctggaggtggcgaacgatatgctcgaggtcggcgtc
gtcgactcccttgcagggggcgttcgcaaggtcgaggagtgctactcggtggcgcacccc
aacggaccggcgtggggcacggccgaccaggatcaactgaagtggctgcagggtctcgat
ggcacctgggttggggagagcaacggccacgcggctctgaacaacagcgaatgggcgaag
gaactgcagcgcctgctcaccctgcacggcggtgaggagagctcgatggagcgcgcgctg
gcgaaactcttcgagaacccggcaatcgccaaggccgcgaaggtagccttggactcgtcg
gcctgtgcgcacagcacggctgaatag

DBGET integrated database retrieval system