KEGG   Leishmania donovani: LDBPK_320550Help
Entry
LDBPK_320550      CDS       T02289                                 

Definition
profilin, putative
Orthology
K05759  
profilin
Organism
ldo  Leishmania donovani
Brite
Exosome [BR:ldo04147]
 Exosomal proteins
  Proteins found in most exosomes
   LDBPK_320550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:188384..188836
Genome map
AA seq 150 aa AA seqDB search
MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYVPQPEEVQHIQKCLSDFSLVQSS
GVNIYGVKFFGLQCGTDGDCKYIFFKKGAAGGCIYTTKQAFIVAVYGNPGDTSSLQQDLE
KNTAHTVTVNPADCNTTVKRIADYLIKLGY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcatacgttgatgacagccttatcggcagcggcaacatgcacagcgct
gctattattggagccgctgatggcagctactgggcgtatggcggtagctacgttccgcag
ccggaagaggtgcagcacatccagaagtgcttgtccgacttctcgctcgtgcagtcctct
ggtgtgaatatttacggtgtcaagttcttcggcctccagtgcggcaccgacggcgactgc
aagtacatctttttcaagaaaggtgcagccggcgggtgcatttacacgacgaagcaggca
ttcatcgttgccgtatatgggaaccccggtgacacctcctcgcttcagcaggatcttgag
aagaacacggctcacacggtcaccgtgaaccctgcggactgcaacactacagtgaagcgc
atagcggattacctcattaagcttggctactaa

DBGET integrated database retrieval system