KEGG   Leishmania donovani: LDBPK_321310Help
Entry
LDBPK_321310      CDS       T02289                                 

Definition
ubiquitin hydrolase, putative
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ldo  Leishmania donovani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:490542..492158
Genome map
AA seq 538 aa AA seqDB search
MGGPPGSQVAQKKPNRPRHKKQEGVSENGASAKGATTLASSNGCGVTAMQAAASPSPFQP
PRQPNVYTDCAPLRELYDQVRLSECGLHGSSVRGGAGRPRRREEKGRPFTLQQSFSELPY
PRGIMNNSNFCFMNSMLQALMFIPSFAQLTVSVSCDAQARQLCPTLATLGKWTLQYWKPG
FTRLAMIAPTLMPRLPAGANNSNSGAPRSAVVPASQRILDGSVQEDAQEFLQKLLERVHE
ELVGLEEAFQQADASEAATESEMGLIAPAATTTTASGGGGGGGGRADAPDDATASTFHKK
GWTFVKGKEKLAVREHEDVQGQSKLLASIFGGTLESHLQGKQRQRDRVSVLIERYYCLPV
DVGFAPECTVEQALERTFMTERIYDSEHEKKLKKTLRLGRLPSVLFLQLRRWAVTREGEL
VKLDNVVRIKRTLLIPRTICADETLGNTERAYRLLSVVCHRGDAVSRGHYVTYLVHHAAT
PAVLKVQSSEPGNKDTAILRLPPDAATVILCNDANISVCPAKNMEKETMYFLVYQKTS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggccaccggggtcacaggtggcgcagaagaaaccaaaccgaccacgacacaaa
aaacaggagggtgtaagcgaaaatggtgccagcgccaagggagcaacgacgcttgcctct
tccaatggatgtggcgtcacagctatgcaggctgctgcgtcgccgtcgccgtttcagcca
ccacgccagcctaacgtgtacaccgactgcgcgccgctgcgagagctgtacgaccaagtt
cgactgagtgaatgcggcctccacggcagtagtgtcaggggcggtgctggtcgaccgcga
aggcgggaggaaaagggacgccccttcacgcttcagcaatccttcagcgaattgccgtac
ccgcgtgggataatgaacaacagcaacttctgcttcatgaattcgatgctgcaggcactc
atgttcattccctcctttgcgcaactgaccgtctccgtcagctgtgatgcgcaggcacgc
cagctgtgccccacgctggcgacccttggaaagtggacacttcagtactggaagcccggt
ttcacgcggctagcgatgatagccccaacgttgatgccgcgcttgcctgctggtgccaac
aacagtaacagcggcgctcctcggtcggccgtggtgcccgcctcgcagcggatccttgac
ggctctgtgcaggaggacgcgcaggagtttctgcagaagttgctagagcgtgtgcatgaa
gagctggtgggtctcgaggaagcttttcagcaggccgacgcgtctgaagcggcgacggag
agcgaaatggggttgattgcccctgctgccaccaccaccaccgccagtggcggtggtggt
ggtggtggtggccgcgccgatgctccggacgacgcgaccgcctcgaccttccacaagaag
ggctggacgtttgtgaagggaaaggagaagctggcggtgcgggagcacgaggatgtgcaa
gggcagtcgaaactgctggcaagtatctttggtggaacgctggagagccacttgcagggg
aagcagcgccagcgcgaccgcgtgtcagtgctcatcgagaggtactactgtctccccgtc
gacgttggctttgcgccggagtgtaccgttgagcaagctctcgagcgcaccttcatgaca
gagcggatctatgacagcgagcatgagaaaaaactcaagaagactctccgcctcggccgt
ctgccctccgttctctttctgcagctgcgccgctgggccgtgacgcgcgagggcgagctc
gtgaagctcgacaacgttgtgcgtatcaagcgcaccttgctgattcctcgtaccatctgc
gctgatgagacacttggcaacaccgagcgagcgtaccgtctcctgtcggttgtgtgccat
cgcggtgacgccgttagtcgggggcactatgtcacctacttagtgcaccatgccgcgacc
ccagccgtcctgaaggtgcagtcgagtgagccgggcaacaaggacactgcaatcctgcgt
ttgccgcctgacgcggcgacagtgattctctgcaatgacgccaacatttctgtgtgtcca
gcaaagaacatggagaaggagaccatgtactttctcgtctaccagaagacaagctga

DBGET integrated database retrieval system