KEGG   Leishmania donovani: LDBPK_323060Help
Entry
LDBPK_323060      CDS       T02289                                 

Definition
ubiquitin hydrolase, putative
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ldo  Leishmania donovani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:complement(1156632..1160657)
Genome map
AA seq 1341 aa AA seqDB search
MSSEGALSSGDAMEEMELKERNHSIEGSSFTATTRDSFASAEEDSTASQVNEEACMTTGK
PRTITWNGTATTAHDYTAASTAETDDEENAAVAAQPQLPLDRLQAYIQALVGNILESLRG
FDGSITWLKRSHSAIAAHLDGINAGAVPAATEEFSVAWFGIASAVLHDLIQESVADIFAL
ATPPLLSSENEESARGLCVTPHELSVAFVSGLQSIVSEVMNDGGCHGSGGSHHFSRYSLR
SFAHVKEISEMSRRLMEEHLTQGAHVPHALRNKYSDDTTPIDCKEDLCSILQSTADAWVC
SFFPAYQQRSRNPTEVAPFLWGEEEDASRLNLELFFYCLYFACQQRSLMQNREALPRGVV
VPTAWMEQLLRWSTQAKEQHCLASPGPHPPFPGPIDTFALMTVSPHDPRRHWLSLDSERY
QVIPETLYNSFFDFFGTGPKYVMYGAFPLRERCLLMWKPLPLTVFTTFEWWERNESDGAL
DKYSVEVPVEEALLHSDMREVCHLAWGVMREEEGMMSDKVARVWFAAINGTDTVRICCKG
LYMLSVKTGPFTIAERGDGMDVTVQEILQQLRRRIEQYMPESVEEWRLQTSGKVLLSLVL
TLNNTNGDDGGGEITRTMEVAAHQCGVCGLTNVGNTCYMNSALQCLSNLTSFRTKLLTLP
ISHFSQAVITPLLIRLLTTMWSGQHSFAETRELKEQIGMRVKRFSGYQQQDANEFIEVLL
DHLSEEINLLSERCYRQREDSDKAIATQELSTIFWSNFLENNKSFIPPLFFHQSKTVFTC
LTCGECSTVFDNNVTLSVSIKDPPQRRAMSVDVMVELSKSDDAAEPVSHSGFMAPLFRPV
KGGTARAHALVTLKVHVLVQPDNTVREQEVEEALRQLLLSNASASREVLRFFLDGSADEM
TAEEEKQRARSVAARVQVDVRVMDIPDHGRVFAWARCYLASADLSVASAPPPTTVGAAGA
PAARVWYFMKDAPLPSTTAIIGTPVWIDEFPASYGAEHPQPAAVDAADAEGLVLASEPRD
CMTAYAEHIRPRSLEVATALLQRVPEDETDEVALFTPTETLSGGAGYVTPPSHKHEAKGK
LASANDAGAAAASIERDIKIVQRILRKSTTASVTKTTFTGDDINTDATGSEACEKAPAST
ALTTTIVVCIQYDSAKYQLVTDGRSSDAFGLRGVGSDITPEVKCSLHECLSHSMQPDLLR
GEDAWFCSRCKEFRETKVHRTLFRLPPCLIVSFKRFKMHTYSADKKNTTVQFPSELDFAP
YLDPESAGLQTEGTKYRLRGVVYHTGSLSFGHYTAAAFNDSVKKWVYYNDTHATIDSCDA
PAPNGAYILCFERVEATASPA
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgaaggagctctgagctctggggacgctatggaggagatggagctgaaggag
agaaaccacagcattgaaggatcttcgtttaccgccactacccgtgacagcttcgcctct
gcagaagaagactcgacagcatcacaggtcaacgaagaagcgtgcatgactaccggcaag
ccgagaaccataacttggaatgggacggctacgacagcgcatgactacaccgctgcttct
acggctgaaacggatgacgaggagaatgctgccgtggcggcgcagccgcagcttccgctc
gaccgactccaggcttatattcaggcgcttgtgggaaacatcttggagagccttcgcggg
ttcgacggcagcatcacatggctaaagcgctcacactcggccatcgcagcccacctggac
ggcatcaacgccggggctgttccggccgcaacggaggagtttagcgttgcctggttcggt
atcgcaagcgctgtgctgcatgacttgatccaagaaagcgtagcggacattttcgctctc
gcgacgccgccgcttctgtccagcgagaatgaggaatcagcgcgtgggttgtgcgtgacg
ccgcacgagctgtccgttgcctttgtctcgggtttgcagagcattgtttcggaggtgatg
aatgacggcgggtgccatggctcgggtggcagccaccacttcagccgctactccttgcgc
agttttgcccatgtaaaggagatcagcgagatgagccgccgtctcatggaggaacacttg
acgcagggagcacacgtgccgcacgcgctgcgcaacaagtacagcgacgatacgacccct
atcgactgcaaggaggacctctgctccattctccagagcactgctgatgcgtgggtgtgc
agcttctttccagcctaccagcagcgctctcgcaacccaacagaggtggcgccgtttctg
tggggggaggaagaggacgcctcgcgccttaacctggagctgttcttttactgcttgtac
tttgcttgtcagcagcggagcttgatgcagaacagggaagctcttccgcgcggcgttgtg
gtgccgacggcgtggatggagcagctgctgaggtggtccacgcaagcgaaggagcagcac
tgcttggcctcacccgggccacacccaccttttccgggcccgatcgacacgttcgcgctc
atgacggtctcgccgcacgacccgcgccggcactggctttctctagactcggagcgatac
caggtgattccagagactctgtacaactccttctttgacttctttggcaccggccccaag
tacgtcatgtatggagcctttcctctgcgggagcgctgtctcctcatgtggaagccgctt
ccgctgaccgtgttcacgacatttgagtggtgggagcggaacgaatcggacggagcgctt
gacaagtacagcgtagaggtgcccgtggaggaggcactcctgcatagcgacatgcgcgag
gtgtgccacctcgcctggggcgtgatgagggaggaggagggcatgatgtcggacaaggtg
gccagagtgtggtttgcggcaatcaacggaaccgacacggtgcgcatctgctgcaaaggc
ctctacatgctttccgtgaaaacaggtccgttcacgattgcagaaaggggggatgggatg
gacgtgaccgtgcaggagatattgcagcagctgcggcggcgcatcgagcagtatatgccg
gagagcgtggaggagtggaggctgcagacgagcgggaaggtgctcttgtccctggtgctg
acgctgaacaacacaaacggcgacgacggcggaggcgaaattacacgcacgatggaggtg
gcagcacaccaatgcggtgtgtgcggcctgaccaatgtcggcaacacatgctacatgaac
agtgcccttcagtgcttgtcgaatctcacctccttccgcacgaagcttttgacgcttccc
atttcgcacttttcacaggcggttataactccgctgctcattaggctgctgacgacgatg
tggtctgggcagcactccttcgcggagacccgtgagcttaaggagcagattggtatgcga
gtgaagcgtttttctggctaccagcagcaagatgcaaatgagttcatagaagtgctcctg
gatcacctgagtgaggagatcaatctcctctcggagcgatgctaccgacagcgcgaggac
agcgacaaggcgatcgcgacgcaggagctctccaccatcttctggagcaacttcttggaa
aacaacaagtcgttcataccgcccctcttcttccaccagtcgaagaccgtcttcacatgc
ctcacgtgtggggagtgcagcaccgtcttcgacaacaacgtcacgctctccgtcagcatc
aaagacccgccgcagcggcgcgccatgagcgtggatgttatggtggagctaagcaagtct
gacgacgcggccgagcccgtctcacacagcggcttcatggcaccgctgtttcgacctgtg
aaggggggcacggcccgtgcgcacgcgctggtgacgctgaaggttcacgtgctggtgcag
ccagacaacacggtgcgcgagcaggaggtggaggaggcgcttcgacagctgctgctgagc
aatgccagtgctagcagagaggtgctgcgcttttttctggacggctctgcagatgagatg
actgcggaggaggaaaagcagagggcaaggagtgtggcagcgcgcgtgcaggtggacgtg
cgcgtaatggacattcctgatcatggtcgcgtgtttgcttgggcacggtgctacctggcg
agcgcagatctgagcgtggcatctgcgccgccaccgactacagtgggtgcagcaggggcg
cctgcggcacgtgtgtggtacttcatgaaggatgcaccgcttccctccacgactgccata
ataggcaccccggtttggatcgacgagtttccggcgtcttacggtgcggagcacccgcag
cctgcggccgtggatgccgccgacgcggagggtctcgttttggccagcgaaccccgtgac
tgcatgaccgcctacgcggagcacatccgcccgcgctctttagaggtggcgacagcactt
cttcaacgcgttccagaagacgagacggacgaggtagcgctcttcactcccacagagact
ctaagcggaggggcagggtacgtcacgcctccatcccacaagcacgaagccaaaggaaag
ctggcgtccgccaacgacgccggcgcagcggctgcatccattgagcgagacatcaagata
gttcagcgcattctccgcaaatccacaaccgccagcgtcacaaaaaccacattcacgggc
gacgacattaacacagatgcgacagggagcgaggcctgtgaaaaggcgccagcttccacg
gcgctgacgaccaccattgtcgtgtgcatccagtacgactctgccaagtatcagctcgtt
accgacggacggagttcggatgcctttggactccgcggcgtaggtagcgacatcaccccg
gaggtgaaatgctcgctgcacgagtgcttgtcgcactctatgcagccggacctgctgcgg
ggcgaggatgcctggttctgcagtcggtgcaaggagtttcgggagacgaaagtgcaccgc
accctcttccgtctgcccccgtgcctcattgtgtcctttaagcgctttaagatgcacacg
tacagcgccgacaagaagaacaccacagtgcagttccccagcgagctcgactttgcgccg
tacctggaccccgaatccgctggacttcagacggagggcacgaagtaccgcctgcgcggt
gtggtgtaccacaccgggtcgctcagctttgggcattacactgcggccgccttcaacgat
tccgtgaagaaatgggtatactacaacgacacacacgcgacgatcgacagctgcgacgcc
ccagcgccgaatggggcgtacattttgtgttttgagcgcgttgaagctacggcaagtcca
gcgtaa

DBGET integrated database retrieval system