KEGG   Leishmania donovani: LDBPK_323830Help
Entry
LDBPK_323830      CDS       T02289                                 

Definition
enoyl-CoA hydratase/isomerase family protein, putative
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ldo  Leishmania donovani
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LDBPK_323830
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LDBPK_323830
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LDBPK_323830
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LDBPK_323830
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     LDBPK_323830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:1453479..1454594
Genome map
AA seq 371 aa AA seqDB search
MYRTGARCSASVLCKDYPHARHITLNRPNSLNALDYGMIRELHRLYVTEPAPPSSLYILT
GAGTKAFCAGGDVIGLATNNPPGCGREFFYWEYQVDYKASIIPAGQVCLWDGYVLGGGAG
LSIGSAYRVASEKACFAMPEVAIGMFPDVGASWFLPRLSVPGLGLYMGLTGHRLRGADLV
HLGLATHFVPSAKMGELEQALVSMSDAGDVEAVLDKYTTPIAQLPPCTIAYSISSLADHF
DITADLTVSSILDACRANAQTDPLTKAAADLMPSFSPTAMTLALELLKRGAKLSTPVEAF
QMEYCVSQRIMAEHDFREGVRALLIDKDKKPKWQPSTVAEVAAEAIDAYFRPTTPNQPVW
DPVAPLSEPAA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcacgggcgcgcgttgcagcgcgagcgtgctgtgcaaagactacccgcatgcg
cgccacattaccctcaaccgacccaattcactgaacgcgctggattatggaatgatacgg
gagctgcaccgtctgtacgtgacagagccagctcctccgtcatccctgtacatcctcacc
ggggcgggcacaaaggcattctgcgccggcggcgatgtgatcggcctcgcgacgaacaac
ccgcccggatgcggtcgtgaattcttctactgggagtaccaagtagactacaaggcgagc
atcattcctgctgggcaggtgtgcttgtgggacggctacgtgctcggcggcggcgctggc
ttatcgattggaagcgcttatcgggtggcgtcggagaaggcgtgctttgcaatgcctgag
gtggccataggtatgttccccgacgtaggggcttcgtggttcctgccgcggctgtcggtg
cctgggctggggctctatatggggctcaccggccaccggctccgcggggccgaccttgtg
caccttgggcttgcaacacactttgtgccatctgccaagatgggcgagctggagcaggct
ctcgtctcgatgtcggacgcaggtgatgtggaggcggtgctggacaagtatacgacaccg
atagcgcagctgccaccatgcaccatcgcctattccatttcttctctcgccgatcatttt
gacatcacggcagatctgaccgtatcgtccatcttggacgcgtgcagagcgaatgcgcag
acggatccgctgaccaaggcagcggcggatctcatgccctccttctccccgacggcaatg
acgctcgcactggagctgctgaagcgcggcgcgaagctgagcacacccgtggaggcgttc
cagatggagtactgcgtttcccagcgcatcatggcggaacacgactttcgcgaaggtgtg
cgagccctgctcatcgataaagacaagaagccgaaatggcaaccgtcaactgttgccgag
gttgcggcggaggccatcgatgcgtacttccgccccaccacaccgaatcagccggtctgg
gatccagtggcgccgctctcggagcccgcagcgtga

DBGET integrated database retrieval system