KEGG   Leishmania donovani: LDBPK_331470Help
Entry
LDBPK_331470      CDS       T02289                                 

Definition
(RefSeq) mitogen activated protein kinase, putative
Organism
ldo  Leishmania donovani
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
33:510256..511482
Genome map
AA seq 408 aa AA seqDB search
MPATKSLAELQAEVCRLDDRYLLERIIGAGSYGVVIRARDTKSDNRLVAMKRVNKEIFEE
VILAKRILREIKLLAHFNDDNIIGLRNILTPEDPENFDHFYIVMDIMETDLKQVLRSGQE
LTEAHIQFFIYQALRALHIIHSAGVIHRDITPANILVNTNCDLKICDFGLAKEENDQGEY
MTDYVTMRWYRAPELVMEDKDYSAQIDVWGIGCILGELLGSRPLFQGKDRVNQLDKIVDV
IGTPSEEDINSVGSSAAQKYLKKKSHRPQADWRQRYPKASPEALDLLRHMLVFNPKRRIT
VLQAMRHPFLEQLHDDADDNLSYALFRFDENEQKTIVDVKRAIYEESVKFHNEHPSSMRA
TTMYSAFNTPSVAAPSVATEGEGRSAQQTIEKNIPENVADGNFDREQV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaccaagtcattagcggagctgcaggcggaggtctgccgcctggatgaccgc
taccttctggagcgcatcatcggcgccggatcctatggcgttgtgattcgcgcgcgtgac
accaagagcgacaaccgccttgtcgccatgaagcgcgtgaacaaggaaatctttgaagaa
gttattctggcgaagcgcattctgcgcgagatcaagctgctggcgcacttcaatgacgac
aacatcattggcctgcgcaacatcctcaccccggaggacccggaaaactttgaccacttc
tacatcgtaatggatattatggaaaccgacctgaagcaggtgctgcgcagtgggcaggag
ctgacggaggcgcacattcagttcttcatctaccaggcactgcgtgcgctgcacattatt
cacagcgccggcgttatccaccgcgatattacgccggcgaacattctggtcaacacgaac
tgcgacttgaagatttgtgacttcggcctggcgaaggaggaaaacgatcagggagagtac
atgacggactacgtgacgatgcgctggtaccgtgcgccggaattggtgatggaggacaag
gactactcagcgcagattgatgtgtggggcatcggctgcatcctcggcgagctactcggc
tctcggccgctcttccagggaaaggaccgggtgaaccagctggacaagatagtcgatgtg
atcggtacgccatctgaagaagacatcaactccgtaggatcgtctgctgcgcagaagtac
ctcaagaagaagagtcaccgaccgcaagctgactggcgccagcgctacccgaaggcgtct
ccagaggcgctcgacctgctgcgccacatgctggtcttcaacccgaagcggcgaatcacg
gtgctgcaggcgatgcgtcacccgttcctggagcagctgcacgatgacgcggatgataac
ctcagctacgctctcttccgctttgacgagaacgagcagaagacgatagtggatgtgaag
cgcgccatctacgaggagagtgtcaagtttcacaatgaacatccatcctcgatgcgggca
acgaccatgtacagcgccttcaacacccccagcgtggccgcaccgagcgtggcaacagag
ggcgagggccgctcggcgcagcagacgattgagaagaacattcccgagaacgtggcagac
ggcaattttgaccgcgagcaagtctga

DBGET integrated database retrieval system