KEGG   Leishmania donovani: LDBPK_331470Help
Entry
LDBPK_331470      CDS       T02289                                 

Definition
mitogen activated protein kinase, putative
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LDBPK_331470
Protein kinases [BR:ldo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   LDBPK_331470
Exosome [BR:ldo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LDBPK_331470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33:510256..511482
Genome map
AA seq 408 aa AA seqDB search
MPATKSLAELQAEVCRLDDRYLLERIIGAGSYGVVIRARDTKSDNRLVAMKRVNKEIFEE
VILAKRILREIKLLAHFNDDNIIGLRNILTPEDPENFDHFYIVMDIMETDLKQVLRSGQE
LTEAHIQFFIYQALRALHIIHSAGVIHRDITPANILVNTNCDLKICDFGLAKEENDQGEY
MTDYVTMRWYRAPELVMEDKDYSAQIDVWGIGCILGELLGSRPLFQGKDRVNQLDKIVDV
IGTPSEEDINSVGSSAAQKYLKKKSHRPQADWRQRYPKASPEALDLLRHMLVFNPKRRIT
VLQAMRHPFLEQLHDDADDNLSYALFRFDENEQKTIVDVKRAIYEESVKFHNEHPSSMRA
TTMYSAFNTPSVAAPSVATEGEGRSAQQTIEKNIPENVADGNFDREQV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaccaagtcattagcggagctgcaggcggaggtctgccgcctggatgaccgc
taccttctggagcgcatcatcggcgccggatcctatggcgttgtgattcgcgcgcgtgac
accaagagcgacaaccgccttgtcgccatgaagcgcgtgaacaaggaaatctttgaagaa
gttattctggcgaagcgcattctgcgcgagatcaagctgctggcgcacttcaatgacgac
aacatcattggcctgcgcaacatcctcaccccggaggacccggaaaactttgaccacttc
tacatcgtaatggatattatggaaaccgacctgaagcaggtgctgcgcagtgggcaggag
ctgacggaggcgcacattcagttcttcatctaccaggcactgcgtgcgctgcacattatt
cacagcgccggcgttatccaccgcgatattacgccggcgaacattctggtcaacacgaac
tgcgacttgaagatttgtgacttcggcctggcgaaggaggaaaacgatcagggagagtac
atgacggactacgtgacgatgcgctggtaccgtgcgccggaattggtgatggaggacaag
gactactcagcgcagattgatgtgtggggcatcggctgcatcctcggcgagctactcggc
tctcggccgctcttccagggaaaggaccgggtgaaccagctggacaagatagtcgatgtg
atcggtacgccatctgaagaagacatcaactccgtaggatcgtctgctgcgcagaagtac
ctcaagaagaagagtcaccgaccgcaagctgactggcgccagcgctacccgaaggcgtct
ccagaggcgctcgacctgctgcgccacatgctggtcttcaacccgaagcggcgaatcacg
gtgctgcaggcgatgcgtcacccgttcctggagcagctgcacgatgacgcggatgataac
ctcagctacgctctcttccgctttgacgagaacgagcagaagacgatagtggatgtgaag
cgcgccatctacgaggagagtgtcaagtttcacaatgaacatccatcctcgatgcgggca
acgaccatgtacagcgccttcaacacccccagcgtggccgcaccgagcgtggcaacagag
ggcgagggccgctcggcgcagcagacgattgagaagaacattcccgagaacgtggcagac
ggcaattttgaccgcgagcaagtctga

DBGET integrated database retrieval system