KEGG   Leishmania donovani: LDBPK_343160Help
Entry
LDBPK_343160      CDS       T02289                                 

Definition
aldose 1-epimerase-like protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ldo  Leishmania donovani
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ldo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1335777..1336682
Genome map
AA seq 301 aa AA seqDB search
MVAFTPDSRGRNCVTIHSEDGSSVTVYEQGAHVSSWKTKDGKEHLYLSPTAIFADRTALR
GGVPLIFPQFGAYGPLQPSHGFARIRSWSIEDAQSGRASFSLRVPLCELLPEDSSLTDSP
QSAVNLLYTICFSNTELKLRMKVTNTSEEQSAPFQFAFHTYFAVSDVSKTVVSGVNRSPF
VDNCKARGNPNTQPSPPEQLWIIRGEHDRVYPDQACAIVLQDLGTKTTLQISSPNLSDVC
LWNPGESKCAAMKDMPPDGYKHFVCVEHGKMLKKVVVPPCSSWTGTQEIAIIAESPRESN
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggttgccttcactcccgactcccgcgggcgcaactgcgtcactatccacagcgaagat
ggctccagcgttaccgtctatgagcaaggcgcgcacgtcagtagctggaagaccaaggat
ggaaaagagcatctgtacctcagccccactgccatcttcgctgaccgcaccgccctgcgt
ggtggcgtgccgctgatcttcccgcagttcggggcttacggcccgctgcagccgtcgcac
ggcttcgcgcgcattcgttcgtggagcatcgaggatgcccagagcggcagggcgagcttt
tcgttgcgcgtgcccctgtgcgagctgctgccggaggattcttctctcaccgattccccg
cagagcgccgtcaacctgctgtacacgatttgcttcagcaacaccgagctgaagctgcgt
atgaaggtcacgaacacaagcgaggaacagtcagcaccgtttcagtttgccttccacacg
tatttcgcagtgtccgacgtttcgaagacggtagtcagcggcgtcaaccgctctcctttc
gtcgacaactgcaaggcgcgcggcaacccgaacacacagccgagcccgccggagcaactg
tggattattcgtggcgagcacgaccgcgtttaccccgaccaagcgtgcgccatcgtcctc
caggacctgggcacgaagaccacgcttcaaatctccagtcctaacctaagcgacgtgtgc
ctctggaaccctggtgagtccaagtgcgctgcgatgaaggacatgccaccggatggctac
aagcactttgtgtgtgtggagcacggcaaaatgctgaaaaaggtggtggtgccgccgtgc
tcgagctggaccggcacgcaggagatcgcaatcatagctgaaagtcctcgtgagtcgaac
atatag

DBGET integrated database retrieval system