KEGG   Leishmania donovani: LDBPK_343750Help
Entry
LDBPK_343750      CDS       T02289                                 

Definition
phosphatidylinositol 3-kinase-like protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ldo  Leishmania donovani
Brite
Protein kinases [BR:ldo01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   LDBPK_343750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1532552..1540438
Genome map
AA seq 2628 aa AA seqDB search
MAETLAPNDVGGISVTKLFSSDSTAALGQQLSSIFSNLNSTPNDRQQRAEECLSALTDTL
FLHENELGANESLHERIISLIDGTFCTSVDKGCSSFRVVFDVKWKDQHEKRNRCFVLLLS
RAFKCTTPEDCLKVIQCLGEVLEDNIRTTTDLLADNVEPLLRDLFAADVHRRTVACEVLA
KIVSTTTFIIKRNPTLLELLTSSCAPLVTLKDAMETRNLWHRTALIRLTSALVENCYEVT
PAVAKDVADLVFRYMRAAEDESQLVGVLSALIHVAVTPAFVSAPWDLPQLVRFLCETDWS
VYAVATRVAAVAAINKVAFFFCQEENACYEALRTRSLEFISLDDAVEVVTEGLELIKEME
VLERELHLGTAVVNALCACIQRLPHVPIIYELLELIRERYGDLEVKPIYSLLEGYLDTKQ
ELLNFGKVNALLRFAGSRIRLDDPRLAQLRINVGANQPIPVILHSLPLLTTLQRTEQLHE
VLEILSHDDRGVRRVAVSTALELCEIMMERNKFRNATPKGGVQRMQWLDEEVSNAVERVL
DVAVADRDPEIRLWALQHLTVPFFPYLCLCDNLDAIFMARNDNDKATRDQALTLLCQLLP
YHPTVVQPQLQRAQEYMLHDVATMDASVSFAVCKAGLLKMCVDHDALLIEKSTVEAIVLR
RLEAQPFISRSLSIALLQLIRSILERTASQHHSDFHSFLRPLLLIVNGGDSCTRRREALE
TLTAFISHITKTDISGLSEVYRAVARIIRRETEEEESVTIAAMKVLSSIGAVTPVKMRHV
FRMVESDEMEEEEEVVTPALAHCKPRLRISTDMPERYPSTVLYYLVRSLQLALDPKQQVD
TLVAVRTMLHDVEGKVKLNLLTQLLPQLQTWLRDPERAFLYETVLGLMNDLAILLCQFKE
SVAPSVGHELLRSVQAFCLLPQASQKPFSAYVVQLLDSLAKGIPAQEMRDNRWAIEFIHQ
RLSQNKNDLDLVHRVVKSLESFIAVMHEKELQMILPHVLQCIEPAKASPGGKLSKSKDIN
DACFDFLNFVMAKQLTLVKHCCAQIVHTIMWYIELADSNEEMDVGLNTLATLVDTVKMPA
KRFIMPIERVAVRNGFPPQYFVNLVQSAAGGAKIRMTTSNGTGLNPDRPITLVSHLPRLS
QAEFEHEMRSTPRSENVLIDVLDVRHHQGQTMIDFRFHPGTDTAACCNLFSRKATDNKSA
MRRNLGILRVEQTEESPRPVGADVIKALANLPVAKTKKREQSWVLWLHNATVTLLRNSPY
AVLRDTCAVADRNTELAKDLFPFAVAAVCGHLETPLRAQLMDIFDRALAAAPADVKQGLF
CFAEFMESERDDDRVKLVKVMRESVFSVDRESTSQKFGINYDQDPERGVIVTKLAPNGLG
ARAGVPIGAQLLAINDIPVRAVSDIRGLIEGLTHIELLLSYEVEEKTKSKPKPLMNLEVL
ASVAFSGEMHIKAIYFNEVLFESLSSKICKITDRKDSQMRRVMTIAEDLIQYYRHLNMTM
TANGLLKTLTRKFSDEIFAPEQFGFEEIASLEQLNWWSEALRRYEARMASFGARYLEVAS
LVGVLRCEQALGHSSRVQELAEQYWEQLPADAQREVAPFRAKAAFCLGAWDTFDALALDK
RMQSCFGVVERCAALFRAECHDELLRYTDKVRESMLESFADSLNENYNRAYEGMTRLQHL
RHFEELVSFTTACEERQALLKRVWHRRLVQMSSRPDDLMTVLSINSLVLEPEDDLHSYVY
VIRCLCKSQWFSHAEHLLQRLLRENASLEVLCECDPELIHTYIKYVYLAKDKHGAYVELK
NILSAVEVDPEDPRAEMWGQCWLLLGEWTMYLFPDCGEEAIKELMCATELGPNSAAAFHS
LGILHCDLARDPSTQGEVQNNHLICCINSLFKSIQLCNDVPGSLVMQDVLRILSVWFANS
SIREINEAVHHGVQVVADHVWLNVVPQLIARIGIEARYARAILTDLLIRVGSQYSHALIY
PLTVAEKSPDAVRRHMAERVIMGMRNIPENDRIVKEASLVSNEMVRIAILWTEKWHAAIQ
QAAYKPNNTAAIFSMLQPLYAELDRASTPNELSFRCNFGQTLRRAKVALEEAKTEEAWGF
LRQVYAQLRRGVLERRLYMSDVSPTLDGIQDSIVAVPGTFEHDKPLITILKFHSRVYVMP
SKQKPRRIGLDASDGKKYRFLLKGHEDMRQDERVMQFIRLIDTIFQSDNAASAIGLSIPQ
YAVIPLTDNVGVVGWVENTETIYKMLETYRQAHEVSIYEEVNLIMKKGGLDTIEDYHRLP
KQQRKALLNYAMENTPKNELRHIFWDHNDTCEQWLSYRQTYGQTLAAMSMVGYVLGLGDR
HLNNLMLQGNGTVVHIDFGDCFEVAMHRALYAEAVPFRLTRLLVCALGITGVDGLYRMTC
ELAMKNLHRHSENLLSILEAFIYDPIINWRLNTVNDVTEKSGSKSAQQESSNGGTAALAG
ETAAAACLGVDDAAQAEAKPVAMQLSKSVSKPVPHSALPGESQMFENGEETRNQQGDLAL
ARVQAKLTGQDFGVVNSSFSMMRSSRRLEAGGSQPQGSSWGSNSLAGFTDSPKDSFAAPL
LTTYLSLRVLNGGAESLDVPHQVDRLIQEATSLDNLSDAFLTGWAPFW
NT seq 7887 nt NT seq  +upstreamnt  +downstreamnt
atggcagagacgctggcccccaacgacgtgggtggcatctccgtcacaaagctcttcagc
agcgatagcaccgccgcgttgggtcagcagctcagctccatcttctcgaatctcaatagc
acgccgaatgaccgacagcagcgcgctgaggagtgcctcagcgccttgacagacaccctt
ttccttcacgaaaacgagcttggcgcgaacgaatcgctacacgagcgcatcatttctctc
atcgacggcaccttctgcacctctgttgacaaaggatgtagctctttccgcgtcgtcttt
gacgtgaagtggaaggatcagcacgagaagagaaatcgctgcttcgttctactgctgagt
cgcgcattcaagtgcaccacgccggaggactgcctgaaagtaattcagtgcctcggcgag
gtactcgaggacaacattcgcacgacgacagaccttttagcagataacgtggagccgctc
ctcagagacctcttcgcggctgacgtgcaccgccgcaccgtcgcgtgtgaggtgcttgcc
aagatcgtttcgacgacaaccttcatcattaagcgaaacccgacactgctggagcttctt
acatcatcgtgtgcgccgctggtgacactaaaggatgcgatggaaactcgcaacctgtgg
caccgcacggcgctcatccgccttacctccgctctcgtggagaactgctacgaggtgaca
ccggcagtggcgaaggacgtggccgacctcgtctttcgctacatgcgcgctgcggaggat
gagtcgcagctggtcggcgttctctccgctctcattcacgttgccgtgacgccagcgttt
gtttcggctccgtgggatttgccacagctggtgcgctttctctgcgagacggactggtct
gtctacgccgtcgccactcgcgtcgccgccgtcgctgccataaacaaagtggcctttttt
ttttgccaagaggagaatgcctgctacgaggcgctgcggacgcgttcgctggagttcatc
tcgttggacgacgctgtggaggtggtgacggaggggctcgagcttataaaggagatggag
gtgctggagagggagcttcacttggggaccgccgtggtgaacgcgctctgtgcgtgcatc
cagcggctgccccacgtgccgatcatctatgagttgctggagctcattcgggaacgctac
ggcgatctcgaggtgaagccgatctattccctcttagaaggctacctagacaccaagcag
gaactgctgaactttggcaaagtgaacgcgctgctgcgcttcgctgggtcgcgaattcgc
ttggacgacccacggctcgcacagcttcgcatcaacgtaggcgccaaccaaccgattccc
gtaatactgcattcactgccgctgctgacaacgctacagcggacggagcagctgcacgag
gtgctggagattctctcgcacgacgaccgaggtgtgcggcgcgtcgctgtctccacagcg
ctggagctgtgcgagatcatgatggagcgcaacaagtttcgaaacgccacgccaaagggc
ggcgtgcaacgcatgcagtggctcgatgaagaagtcagcaacgcggtggagcgtgtgctc
gacgtcgccgtggcggaccgcgacccggagattcggctttgggcgctgcagcacctgacc
gtgcccttcttcccgtacctgtgtctttgcgacaacctggatgccatcttcatggcacgc
aacgacaacgacaaggcaacacgggaccaggcgctgacgctgctgtgccaactgctccca
tatcacccgacggttgtacagccgcagctgcagcgtgcgcaggagtacatgctgcacgac
gtcgccaccatggacgcgtccgtgtcctttgcggtgtgcaaggccggcctgctgaagatg
tgtgtggaccacgatgccctcctcattgagaaaagcactgtcgaggcgattgtgctgcgg
cgtctggaggcgcagcccttcatctctcgatcgctctccatcgctttgctgcagctcatt
cgctcgatcctggagcgcacagcctcgcaacaccactccgacttccactcgtttttacgg
ccgctcctcctcatcgtcaacggcggcgactcgtgcacacgccgccgcgaggcgttggag
actctgacggcgttcattagtcacatcaccaagacggacatttcagggctgagtgaggtg
taccgagcggtcgcccgcatcatccgtcgcgagacggaagaggaggagtctgtgacgatc
gctgccatgaaggtgctcagctccatcggggctgtgaccccggtgaagatgcgccacgtc
ttccgcatggtggagtcggacgagatggaagaggaggaggaggtggtgacgccggcactg
gctcactgcaagccgcggctgcgcatttccacggatatgccggagcgctacccctccacc
gtgctgtactacctcgttcgctcgctgcagcttgcgttggatccgaagcagcaggtggac
acgctggtagcggtgcggacgatgctgcatgatgtggaaggcaaggtcaagctcaaccta
ctcacccagctacttccgcagctgcagacgtggctgcgcgatccggagcgtgcgtttctg
tacgagacggtgctgggcctgatgaatgacctcgccattctgctttgtcagtttaaggag
tctgtagcaccatccgtcggccacgagctgctccggtctgtgcaagccttctgccttctt
ccgcaggcgagccagaagcctttcagcgcgtacgttgtgcaactgctcgacagcctggca
aaaggcatcccggcgcaggagatgcgggacaaccggtgggccatcgagtttattcaccag
cgactctcgcagaacaagaacgaccttgacctggtgcaccgcgttgtcaagtccctcgag
tccttcattgcagtaatgcacgagaaggagctccagatgatcctgccccacgtgctgcag
tgcatcgagccggcgaaagcatctcctggcggcaagctctccaaatcgaaagacatcaac
gacgcctgcttcgacttcttgaactttgtgatggcgaagcagctgacgcttgtgaagcac
tgctgtgcgcagattgtgcacaccatcatgtggtacattgagctggccgacagcaatgag
gagatggatgtcggcctcaacacgctcgcgacgctggtggacacggtgaagatgccggcg
aagcgatttatcatgcccatcgagcgcgtggcggtgcgcaacggcttcccgccgcagtac
ttcgtgaaccttgtgcagagcgctgccggtggtgcaaagatccgcatgacgacgtcgaac
ggcacaggcctcaacccggaccgccccattacgctggtgtcacacctgccgcgtctgtca
caggccgagtttgagcacgagatgcgtagcacgccgcgctcggagaacgttctcatcgac
gtgctagacgtccgccaccaccaaggccagaccatgatcgacttccgctttcaccctggc
acggacacggcggcgtgctgcaaccttttcagccgcaaggccaccgacaacaagtccgcc
atgcgccgaaatttgggcattctgcgcgtggagcagacggaggagagcccacggccggtc
ggggcggatgtcatcaaggcactggcgaacttgccggtggcgaagacgaagaagcgagag
cagtcctgggtgttgtggctgcacaacgctacggtgacgcttctgcgcaattctccgtac
gccgtgttgcgggacacctgcgccgtcgcggaccgcaacacggagctggccaaggatctt
tttcccttcgccgtggctgccgtgtgcgggcacctcgagacgccgctgcgggcgcagctc
atggacatctttgaccgcgcgcttgctgcggcacctgccgacgtgaagcaggggctcttc
tgcttcgccgagttcatggagagcgagcgcgatgatgaccgcgtgaagcttgtaaaggtg
atgcgagagagtgtattcagcgtggatcgcgagtcgaccagtcagaaattcggcatcaac
tacgaccaggacccggaacgaggtgttattgtgacgaagctggctccaaacggcctcggc
gcccgcgccggtgttccgatcggggcgcagctgctcgctatcaacgatatcccggtgcgt
gcggtcagcgatattcggggcctcattgagggactgacgcacattgagcttttactgtcg
tacgaggtggaagagaagacgaaatcgaagccgaagccgctcatgaacttggaggttctg
gcgtcggtcgccttcagtggggagatgcacatcaaggccatctactttaacgaggtgctc
ttcgagagcctctccagcaaaatctgcaaaattacggaccgcaaggacagccagatgcgc
cgcgtcatgacgattgccgaggatctaattcagtattaccggcacttgaacatgactatg
acagccaacgggctgttgaagacactcacgcgcaaattttccgatgaaatctttgcaccg
gagcagttcggcttcgaggagatcgcgtcgttggagcagctgaactggtggagcgaggcg
ctgcggcgatacgaggcgcgcatggccagcttcggcgcccgttacctcgaggtggcgtcg
cttgtgggcgtgctgcggtgtgagcaggcgctggggcactcgagccgcgtgcaggagctc
gccgagcagtactgggaacagctgccggccgacgcgcagcgagaggtggcaccgttccga
gctaaggcagccttctgccttggggcctgggacacctttgatgcgctggcgttagacaag
cgcatgcagagctgcttcggcgtcgtcgagcgctgcgccgcactgtttcgggctgagtgc
cacgacgagctcttgcggtacacagacaaggtgcgcgagtcgatgctcgagtccttcgcc
gactcgctgaacgagaactacaaccgcgcgtacgagggcatgacgcgtctgcagcacttg
cgccatttcgaagaactcgtctcattcaccacggcttgcgaggagcggcaggcactgctg
aagcgcgtgtggcatcgccggctcgtgcagatgtcctcccggccggacgacctcatgacg
gtgctctccatcaactcccttgtgctcgagccggaggacgacctgcactcgtacgtgtat
gtaatccgatgcctgtgcaagtcacagtggttctcccacgcggagcacctcctgcaacgg
ctgctgcgtgagaacgcctctctcgaggtcctatgcgagtgcgacccggagctgatccac
acctacatcaagtacgtgtacctcgccaaggacaagcacggagcgtacgtggagctgaag
aacatcctgtccgccgtcgaggtcgaccccgaagacccgcgagccgagatgtggggacag
tgctggctgctgctgggcgagtggaccatgtatctcttccccgattgcggcgaggaggcc
atcaaggagctcatgtgcgccacggagttgggccccaacagcgccgccgccttccattcg
ctcggcattctgcactgcgatctcgcccgagacccgagcacacagggcgaggtgcagaac
aatcacctgatctgctgcatcaactcccttttcaaatccattcagctgtgcaacgacgta
ccgggcagcctcgtgatgcaggatgtactacgcattctctccgtctggttcgccaacagc
agcatacgagagatcaatgaggcagtgcatcacggcgtgcaggtggtggcggaccacgtg
tggctgaacgtggtgccacagctcattgcccgcatcggcatagaggcccgctacgcccga
gccatcctgaccgacctgctcattcgcgtagggtcacagtactcccacgccctcatctac
cctctcacggtggccgagaagtcgccagacgcggtgcggcggcacatggcagagcgcgta
atcatgggcatgcgcaacatcccagagaacgaccgcattgtcaaggaggcgtccttagtg
agcaacgaaatggtgcgcatcgccattttgtggacagagaagtggcacgcggcgattcag
caggcggcctacaagccaaacaacacagccgctatcttctccatgttgcagcctctgtac
gcggagctcgaccgcgcctccaccccaaacgagctcagcttcaggtgcaacttcgggcaa
acgctgcgccgcgccaaggtggccctggaggaggcaaagacggaggaggcgtgggggttc
ttgcggcaggtgtacgcgcagctgcgccgcggcgtgctagagcgtcggctgtacatgagc
gacgtctcgccgacgctggatggcattcaagacagtattgtggcagtgcccggcaccttt
gagcatgacaaacccctcatcacaattctcaagttccacagccgggtatacgtgatgccg
tccaagcagaagccgcgccgcatcggcctcgacgcgtccgatggcaaaaagtaccgcttc
ttactcaagggccacgaggatatgcggcaggatgagcgcgtcatgcagttcattcggctc
atcgataccatcttccagtccgataacgcggcgagtgcgattggactgagcatcccgcag
tacgctgtgattccgctcaccgacaacgtcggcgtcgtcgggtgggtggagaacacagag
acgatctacaagatgctggagacgtacaggcaggcacacgaggtttccatctacgaggag
gtcaacctcatcatgaagaaaggtgggctggacacaatcgaggactaccaccggctgcca
aagcagcagcgaaaggcgctgctgaactacgcgatggagaacacgccaaagaacgagctg
cgccacatcttctgggatcacaacgacacgtgtgagcagtggctgagctaccgccagact
tacggccagacgctggcggccatgtctatggtcggctacgtgctcggcctcggtgaccgc
catctcaacaacctgatgctgcaaggcaacgggacggtggtccacatcgactttggcgac
tgcttcgaggtggccatgcatcgcgccctctacgccgaggctgttccgttccgcctgaca
cgtctgctcgtgtgcgctctcggcatcaccggcgtagatggtctttaccgcatgacatgc
gagctggccatgaaaaaccttcaccgccacagcgagaacctgctgtccattctcgaggcc
ttcatctacgaccctatcatcaactggcgactcaacacggtcaacgatgtcacggagaag
tccgggtccaagtcggcgcagcaggagagcagcaacggcggcaccgctgctctcgcaggc
gagacggctgcggcggcctgcttgggggtcgacgacgcagcacaagcggaggccaaacct
gttgcgatgcagctgtccaagtccgtttcgaagccggtgccgcactctgccttgccaggg
gagagccagatgttcgagaatggtgaggagacgcgcaaccagcaaggagacttggctcta
gcacgggtgcaggcgaagctcaccggccaagattttggcgtggtgaacagttccttctct
atgatgcgctcctcgcgccgtctcgaggctggcggctcccagccgcaggggtcatcgtgg
ggctcgaacagtctcgccggcttcaccgactcgccgaaggactcgttcgcagcgccgctc
ctcaccacctacctctccctccgtgtgttgaacgggggtgcggagagcctcgacgtgccg
caccaggtcgaccgcctcattcaagaggcgacgagcctcgacaacttgtccgacgcgttt
ctcaccggctgggcacccttctggtag

DBGET integrated database retrieval system