KEGG   Leishmania donovani: LDBPK_343890Help
Entry
LDBPK_343890      CDS       T02289                                 

Definition
ubiquitin hydrolase, putative
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LDBPK_343890
Peptidases [BR:ldo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LDBPK_343890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1580708..1583428
Genome map
AA seq 906 aa AA seqDB search
MRSGYVGIYNQGSTCYLNSVIQALYHLPAFRTQIYNLPNVQKDSVALALRDVFAQLEVRN
RNTTTTELTKAFGWSAQEAAVQHDVHELMQQLFDSLETTLKETPKKNMIRDMFGGLMIYR
SRAIDGAEYLSDRLEDFYDVELVVQNKANIEESLREFSSGERIEGVCVEVMPGADATPHT
IERSQHFLDCPKVLLVHPNRVAFDMETYELVTLRNVWSFDFNLSLASYVVDDASLKLDKE
SQEKWKKLSHRTHLGANYSLRSILTHAGDATIGHYYVYVNFDGEWVRFNDEVVEPATEED
VRKSAFGGQSIQSRYRLFDNERASLLIYVNDDVKEELLNETPPPSAIVEVGRHIEEERAR
KEETHKVSYYLCDKFVVDVLDGVHGASDKLQRHMSVRLSPGQDEMTAIITTAAKELRVAP
EQIRIFCRDRHGLSPWCAVESMCNSYDSYYYPPIFIDIAPPLAEEDAASATIAAAAAEPF
LAFLRNVESPHDRDVPVTIVRSIPELQARVPRDAVVYESRGGPQYLNAITATNQLVCGAN
LLYTHQRSSNDAVRGYLQQRQLVCTKVYLYDDYTAELTELFEINIVESTPYTTLQAGLYK
MMTESKRGLPIPPSHNHLAFFKGNDRCNYAFAMPMAASLTIQWNTYNHTLRDVWGSVQHE
HKIVMTILPMPLEKIDLTVLVTFNGGYNNLPHVYVPVEGGSVTFRELLELMVQQLGSRLR
AGAAAGYEQQLTGQARLLRLLRVRRGELVEVVEDLDTPIDLEAREDIVLDKLCPALPGYE
LVNVLFCRRRSGEYYFGLPTNICINSSLEEQGDVLLRRIVKKLGYPDQEEAMKKWILCVM
NVKSRKTRTASKKEVLADLVKEVGGAPFVFVVDRPQCLLLDGIEEEEHRPESIVIKSASK
TDLSAA
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcggggtacgttgggatctacaatcaaggtagcacgtgctacctgaactcggtc
atacaggcgttgtaccacctacccgccttccgtacgcaaatttataacctcccgaatgtg
caaaaagactccgtcgcactcgctctgcgggacgtgtttgcgcagctggaggtgcgcaac
cgcaacaccaccacgacggagctgaccaaggcttttggctggtcggcgcaggaggcggca
gtgcagcatgacgttcatgagttgatgcagcagctctttgacagcctcgaaacgacgctg
aaggagacgccgaagaagaacatgatccgtgacatgtttggcggcttgatgatctaccgg
tctcgtgccatagacggcgccgaatacctctctgaccgcctcgaggatttctacgacgtg
gagctggtagtgcagaacaaagcaaacatcgaggagtcactgcgggagttctcatccgga
gagcggatcgaaggtgtctgtgtggaggtgatgcctggtgcggacgcgacgccgcacacg
attgagcgcagtcagcacttcctcgactgccccaaggtgctcttggtacacccgaaccgc
gtggcgtttgacatggaaacatacgagctggtcacgctacgtaatgtgtggagttttgat
ttcaacttatcgctggcgagctacgttgtcgatgacgcctcgctgaagctcgacaaggag
agtcaggaaaaatggaagaagctcagtcaccgcacccacctcggcgcgaactacagcctg
cgctccatcctcacgcacgccggcgatgccaccatcgggcactactatgtgtacgtcaac
ttcgacggggagtgggtgcgcttcaacgacgaggtggtcgagccggcaacggaggaggat
gtgcgcaagtccgcgtttggcgggcagtcgattcagtcgcgctaccgtctcttcgacaac
gagcgcgcgtcgctgcttatctacgtgaacgacgatgtcaaggaggaattgttgaacgag
acgccgccaccgagcgcgatcgtggaggtgggccgccacattgaggaagagcgcgctagg
aaggaggagacgcacaaggtgagctactacctatgcgacaagttcgtggtggacgtgctc
gacggcgtgcacggcgcctccgacaagctgcagcgtcacatgtctgtgcgcctctcgccc
ggtcaagatgagatgaccgccatcatcactactgcagcgaaggagctgcgcgtagcgcca
gagcagattcgcatcttctgccgcgaccgtcacggcctctccccatggtgtgctgttgag
tcgatgtgcaactcgtacgactcatactattatccgcccatttttatcgacatcgcgccg
ccgctcgcggaagaggatgcggcgtccgccacgattgccgctgccgccgccgagccgttc
ctcgcgttcctccgtaatgtcgaatcgccgcacgaccgcgacgtccccgtcacgatcgtc
cgctccatcccggagctgcaagcgcgagtgccgcgcgatgcggtcgtgtacgaaagccgc
ggcggcccgcagtacctgaacgccatcacagcgacgaaccaactcgtctgcggcgcaaac
ttactttatacgcaccagcgctcctccaacgacgcggtgcgcgggtaccttcagcagcgc
cagctcgtctgcacaaaggtctacctgtacgacgactacaccgccgagttgacggagctc
tttgaaataaatattgtcgaatccacgccctacaccacgctgcaggccgggctgtacaag
atgatgacagagtcgaagaggggcctgccgatccctccctcccacaaccacctcgcgttc
ttcaagggaaacgacagatgcaactacgccttcgcaatgcccatggcggcgtcgctcacg
attcagtggaacacgtacaaccacaccctccgagatgtgtggggtagcgtgcagcacgag
cacaaaattgtcatgacaattcttccaatgccgctcgaaaagatcgacttgacggtgctg
gtgacgttcaacggaggatacaataacttgccgcacgtgtacgtcccagtggagggtggc
agcgttacttttcgcgaacttcttgagttgatggtgcagcagttgggcagtcgtcttcgg
gcaggcgctgccgcggggtacgagcagcagctcaccgggcaggcacggctgctgcggctg
ctgcgggtccgacgaggcgagctggttgaggtggtggaggacctggacactccgattgat
ctcgaggcacgcgaggacattgtcctggacaagctgtgcccggcactgcccgggtacgag
ctcgtcaacgtgctcttctgccgccgccgctcaggagagtactactttggtctaccgaca
aacatctgcatcaactcgtctctcgaggagcagggcgatgtgcttcttcgacgcatcgta
aagaagctcgggtaccctgaccaggaggaggcaatgaagaagtggatactttgtgtaatg
aacgtcaagtcccgcaagacgcgcactgccagcaagaaggaggtgctggcagatctcgtc
aaggaggtcggcggcgcaccgttcgtgttcgttgtcgaccgtccccagtgcttgctcctc
gacggcattgaagaggaggagcaccggccagagtccatcgttatcaagtctgcctcgaag
acagacctctccgcggcttag

DBGET integrated database retrieval system