KEGG   Leishmania donovani: LDBPK_344160Help
Entry
LDBPK_344160      CDS       T02289                                 

Definition
phosphatidylinositol 3-kinase (tor2)-like protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ldo  Leishmania donovani
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1669457..1676770
Genome map
AA seq 2437 aa AA seqDB search
MSSVDSDKLATSIRALAGSRDERIAFVTEGVKQAKELQGKSVQEYEMVVSSLLMCLESFE
VVHGTSLDVLCELTVLDILLNLDLSVIQLSQCNSYLRLCLMAVNEIPVAVAAAKTFAQTL
SYSMTTDFVRTQIGETLEWISLSDAKSQPRRICGILVLTEVALRIPMVILPRLSEVFDRA
WDCLVVHDEEVRSRALCLFTLCAKLLVNRPAAIRAETCDALMSHLKGNLASKSKDKRIAG
LLAFEPIVINSIGTSNIRYEDLSNLLVPYIMGGGANVNADTRELLFRCLVVLCRFSAPQF
VAHQLKESVRFALDSINRNIQRNTAFEMLSEIIPIVGKTEFAPFVDDTCEVIKTIFEKSP
SPCWKALQCFSIICKECRPSKMETYVESCIENVFVWGLSAELIECMRAIIESSSVQYRAK
LEESLLDMISVTLCGLPFRQQIDAPRVSESSTDVSASEYQISVALNALKQFGFSNSELMG
DFLRVSVLPFIDNNSVAVRNAAVYTIVKLLIPPGEKGDLSIARRMCVNTVITRMLVVGLS
DPNPVVRQTILSAFTEDFYPYLSEQQYLFRFYSALGDESINCRVAATEQLCQMIRYDPSH
ILPALREEMVVILHFITSTFNMDTVQNGFRLLAAIATRAPQLVVNFTEGICEALVPYFST
LSSRSGILLSFLHCCTAVAAALRKFGSTPFSSKREIALVCELLETLPADRSYHIIRLSCL
RFLSATLAPLMEGASPYVLYPRLFQQLCTVLHRTEESVDIRLEALRCIGVIGALDSHVFQ
SFNLNEEKASGMSAVVVDRVTHVKCCRIVLCAVAALLDPESKRSAGAREGLLRTGVQTML
NIFEHVPCSKSEIGLVIGPLARVIRQLPGGRLFATVLFEFCNIIRYGGAVVLNDLNEIYR
VFDNVWEFQVNYRFLAVRMLSFVANFEASGNLHYGQQHSRILPQLFDTLNRADLRADLKY
AVLEYIVRHVDSLQPCTEAAVDNLLGAIQNPANPLDFVNHCVVTLKEICVKLYVDELVGA
IVRCLLACLSVDLARKTRGRDSIALCNNIMGVFCVLIEELQGNFLKYSTYIIQALKNYRI
TNTEFGVMNNRVATGLRCARSAMSIQQQNAEVAALLKTCESVVMKSMSRMGEVWSYANLN
DDNANAGAAEERTMPINEQRLINPMKVVPLTKEEWVKWSDQFAITLLQESPFQVFRCTAV
PIGINAAPLVEKSTQFVQDTLQIAFRSMWNYASSALQTAITDFFRQSFRQAMMSTTVPAE
VVTMLLGIVEYMDHVGEALFISYNDLSECAWNRGMLAKALFWREAAYRDDPVGTVESLIS
LYSELHMVDSSVGILNMTSEEQRRSLLQTSLVKLARYTEALQLTQQELELEAAPLEESST
ENLSKGCGYKNGSRGWSRMLHYTSNSDLTPSSSKAEESCRDRRVEVNARLMLCLSELGEY
DRVLEQWGSMLHNYKDRVTDTDEMHVLFFVSQYAADASIRLQSWDTLEHVLDWLPPDMVL
YHVSKAALEVVRGNYDAALVSVTNGRKVLLEDLTSLLHESYARAYEGLVVAQQLTEVEEV
IIAKQTQKALSSAAHIPHLCHIWEQRIRMMHATVPTWKQVLGIRGLLISPHEDVKTRIQF
TKLCRQEKARQLEKFTLAELLGFANPTLEQLTSRNVNPRVVMQYISYLSETNALGPGSAF
GTESDLIKKMIDVHTKAENSAVLARAYTRLGSKVDLIESVQCFKTAIMYDPQWFLAWRKW
AEANAQLLQTDKGEETCRNAIEGFIRSIQLGTSDSTLIQDVLKLLTLWSSHCDSDHNLKE
LRERVFDVPSRVWHLVVPQLVARLDTGSDDSCRLVADVLTNVGYDYPHTLVYPLNLCTMS
DSERRNRYSNEVLGKLQERYPVIVLQGRLMIDELIRVSSLIYEQWYDKLEAAATAFFGRR
STDEMIRTLLPIHETLTRVPETVVESEFLSKYSKRLTEARDWLRSYSSTRYTGDIQSAWK
LYHSVYCNIDKQIKSSDTLQLQFCSPKLFEARNLSIGIPDARPVREESVAKVNRFQKDII
VIASKQRPKRIGIITAEGRLQKFLLKGREDLRLDERVMQLFSLVNILMQSDSRTSKNLGF
QIQRYSVTPLKDNVGIIGWVDGCDTLHEVVKHFRERKSIPVELEMRMLDQIITFDNSKAY
DYLTIMSKVEVLEFLSDHTSGQDIRKAMWNTSPNCEVWYDRRRMYTTSLANMSIVGYILG
LGDRHPNNIMLQRASGLVVHIDFGDCFEVAMTRDKFPEKVPFRLTRMLRSALDVSGVDGA
FRACSETAMCVLREGSHSVLALLEAFIQDPLISWRLINRHGQEPESSNDHKTIEEQVNIA
NMRNATSTAGAESMCDSVGKRDSGTFSVAKHLCGEEVDVVHQGVFIVKRLSSKLKGQDFI
SAGTEPLDPRTQVGQLIEEATDVTNVAQSWSGWYPFW
NT seq 7314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggtcgactcggataaactcgcgacctccatccgcgcactagccggcagtcgc
gacgagcgtatcgcctttgtgacggagggcgtgaagcaggcaaaggagttgcagggcaaa
agcgtgcaggagtatgagatggtggtgtcgtcgctgcttatgtgtctggagagctttgag
gtggtgcacggcacgtcgcttgatgtgctctgcgaactcactgtcctggacattctgcta
aacctagacttgtctgtcatccagctgtcgcagtgtaacagctacttgcggctttgcctc
atggcggtgaatgaaattcccgtcgctgtggcagctgcaaagacgttcgcgcagacgctt
agctacagcatgacgacggactttgtgcgcactcaaatcggagagacactcgagtggatt
tcgctctccgacgccaagtcgcagcctcgtcgcatttgtggcatcttggtgctcacggag
gtagcgttgcgcattccaatggtaattctgccgcggctctccgaggtgttcgacagggct
tgggactgcttggtggttcacgacgaggaggtccgctcacgcgctctgtgtctcttcacg
ctatgcgcaaagctgctggtcaaccgccctgccgccattcgtgctgaaacctgcgacgca
ttgatgtcacacctgaagggtaacctcgcctctaaatcgaaggacaaacgcattgctggc
ctccttgcattcgagcccatcgtcatcaactcgatcggcaccagcaacatacgctacgaa
gacctctccaaccttctagtcccctacattatggggggcggcgccaacgtcaacgccgac
acgcgcgagctcctgtttcgctgcctggttgtcctctgccgcttcagtgcaccacagttt
gtcgcgcaccagctcaaggagagcgtgcgcttcgcgctggattccatcaaccgcaacatt
cagcggaacaccgccttcgagatgctctctgagatcattccgattgtaggcaagacagag
tttgcgcccttcgtagacgacacgtgtgaagtaatcaagaccatttttgagaagtctccg
agcccgtgctggaaggcgctgcagtgtttctccatcatctgcaaagagtgccggccatcc
aagatggagacatacgtggagtcgtgcatcgagaacgtgtttgtgtggggcctttccgcg
gagctgattgagtgcatgcgcgccatcatcgagtcgtcgagcgtgcagtaccgagcaaag
ctggaggagtcgctgcttgacatgatctccgtcacactatgcggtctcccatttcgacag
cagatcgacgcgccgcgcgtcagtgagagctctacggatgtgagcgcctccgagtatcag
atctccgttgccctgaacgccctcaagcagttcggcttctccaactcggagctcatgggc
gactttctgcgcgtctcggtgctgccttttatcgacaacaacagcgtcgcggtgcgcaac
gcagctgtctatacgatcgtcaagcttctcatcccccctggcgagaaaggcgacctcagt
atcgcacgtcgcatgtgcgtcaacaccgtcatcacgcgcatgctggtcgttgggttgtca
gaccccaatcctgtggtgcgtcagaccattctgagtgcctttacagaggacttttatcca
taccttagcgagcagcagtatctctttcgcttctactctgccctgggtgacgaatccatc
aactgtcgcgtggcggcgacggagcagctgtgccagatgatccgctatgacccatcgcac
attctgcctgcgctacgagaggagatggttgtcattctacacttcattacgtctaccttc
aatatggacaccgtccaaaacgggttccgcctcctcgccgcgatcgccactcgcgcgccg
caactcgtagtgaactttacggaaggcatctgcgaggctctggtgccgtactttagcact
ctctcctcccgctccggcattctcctgtcgttcttgcactgctgcacagccgtcgcggcg
gcgctccggaagtttggtagcacccccttctcctccaaacgtgaaatcgctcttgtgtgt
gagctgctggaaaccttgccggcggaccggtcgtatcacatcatccggctgtcctgtctc
cgcttcctctcggcaacccttgcgccgctcatggaaggtgcctcgccttacgtgctgtat
cctcggctctttcaacaactctgcacggtgctgcacagaacagaggagagcgtcgacatt
cgccttgaagcgctgcggtgcattggcgtgatcggtgcgctggactcgcacgtgttccag
tcgttcaatctcaacgaggagaaggcgtctgggatgagcgcggtggtggtggacagggtg
acacacgtgaagtgctgccgtattgtgctctgcgctgtggcagcgctgcttgacccggag
agcaagcgctccgccggcgcgcgcgaagggctcctgcgcacgggtgtgcagacgatgctg
aacatctttgagcatgttccgtgctccaagagtgaaatcggtctcgtgatcgggccgctg
gcccgcgtcatccggcagctgcctggcggccgcctctttgcgaccgtgctcttcgagttc
tgcaacatcattcgctacggcggtgcggtggtgctcaacgatttgaatgagatttaccgc
gtatttgacaacgtatgggagttccaggtcaactaccgatttctggccgtgcgcatgctc
tcgtttgtcgccaacttcgaagcctccggcaatttgcactacggccagcagcactcgcgc
atcctgccgcaactcttcgacacgctcaaccgtgctgacctgcgcgccgacctcaagtac
gccgtacttgagtacattgtgcgtcatgtcgactccctgcagccgtgcacggaggcggcg
gtggataacctgctcggcgccatacagaacccggcaaatccgcttgactttgtgaaccac
tgtgtggtgacgcttaaggagatctgcgtcaagctgtatgtcgatgagctcgtcggcgct
attgttcgatgtctgctggcatgcctctccgtcgaccttgcacgcaagacacgcggacgc
gatagtattgctctctgcaacaacatcatgggggtcttctgcgtcctgatcgaggagctg
cagggcaattttctcaagtactcaacgtacattattcaggccttgaagaactaccgcatc
acaaacacggagtttggcgtaatgaacaaccgcgtcgccaccggcctccgctgtgcacgc
agcgcaatgtcgatccagcaacaaaacgcggaggtggccgcgctactgaagacatgcgaa
tctgtcgtgatgaagagcatgtcgcgcatgggcgaggtctggagctacgcgaacctcaac
gacgacaacgcaaatgcaggggccgccgaggagcgcaccatgcccatcaacgaacagcgt
ctcatcaatccaatgaaggttgttcccctgacgaaggaggagtgggtcaagtggtcggac
cagttcgccatcacgctgctgcaagagtcgccgtttcaggtcttccgctgcacggcggtg
cccatcggcatcaacgcagccccgctggtcgagaaatcgacgcagtttgtgcaagacaca
ctccaaatcgcctttcgatccatgtggaattacgcgagctcggcgctgcaaaccgctatc
acagactttttccgtcagtcgtttcgtcaggcgatgatgtcgaccactgtcccggcggag
gtggtgacgatgttgcttggtatcgtggagtacatggaccacgttggtgaggccttgttc
atctcgtacaatgacctctccgagtgtgcgtggaaccgaggaatgttggccaaggcgctc
ttttggcgcgaggccgcctaccgcgacgaccctgtcggcaccgtcgagtcgctcatctct
ctctacagtgagctacacatggtggactcctccgttggaatcttgaacatgacgagcgag
gagcagcggcgcagcctgctgcagacaagcctggtcaagctcgcgcgctacacggaggcg
ctccagctgacgcagcaggagctggaactggaagctgccccgttggaggagagtagcacc
gagaacttatccaagggctgcgggtacaagaacggcagccgcggctggtctcgcatgctg
cactacacgtccaacagcgacctcaccccgtcctcctcaaaggcggaggagagctgtcgc
gaccgccgcgttgaggtgaacgcgcgactgatgttgtgcctgagcgagcttggcgagtac
gacagggttctggaacagtggggcagcatgctccacaactacaaggaccgcgtgacagat
acagacgagatgcacgtgctgttttttgtctcgcagtacgccgcagacgcgtcgatccgg
ctgcagtcgtgggacacgctggagcacgtcctggactggttgccgccggacatggttctc
taccacgtgtcaaaggcggctctggaggtggtgcgcggcaactacgacgccgcgctcgtc
tccgtgacgaacgggcgcaaggtgctgctggaggatctgacaagcctgcttcacgagtcg
tacgcgcgcgcctacgaggggctcgtggttgcgcagcagctgacggaggtggaggaggtc
atcatagcgaagcagacgcagaaggcgctcagctccgctgcccacataccgcatctctgc
catatctgggagcagcgcattcgaatgatgcatgcgacggtgccgacatggaagcaggtg
ctggggatccgtggcctgctcatctcgccccatgaggacgtgaagacgcgcatccagttc
accaagctctgtcggcaggagaaggcgcggcagctagagaagtttacgctggccgagctc
ctcgggttcgccaacccgaccctggagcaactcacgagccgcaatgtgaacccacgcgtg
gtaatgcagtacatctcatacctctccgaaaccaacgcacttggccctggcagcgccttc
ggaaccgagagcgaccttatcaagaagatgattgatgtgcacaccaaggcagaaaactcg
gcagtgttggcgcgggcctacacgcgtctcggcagcaaggtcgatctcatcgagtcggtg
caatgcttcaagactgccatcatgtacgatccacagtggtttctggcatggcgtaagtgg
gccgaagcgaacgcgcagctgctccagactgacaagggcgaagaaacgtgccgcaacgct
atcgagggctttatccgaagcattcagcttgggacgtccgactcgacgctcattcaagac
gtgctcaagctgctgacgctctggtcgagccactgcgactctgatcacaacttaaaggag
ctgcgcgagcgtgtcttcgatgtgccgtcgcgcgtgtggcaccttgtggtgccacagctg
gtcgcccggctcgacaccggctccgacgacagctgccggcttgtggcggatgtcctgacg
aacgtgggctacgactacccccacacgttggtgtacccgctgaacctgtgcaccatgtct
gattcggagcggcgtaacaggtactccaatgaggtgctgggcaagctgcaggagcggtat
ccggtgattgtgctgcagggtcgtctcatgattgacgaacttatccgcgtctcgtccctc
atctacgagcagtggtatgacaagctggaggcggcggcgacggccttctttggccgccgc
agcaccgacgagatgatacgcacgctgctgccgattcacgagacgttgacacgggtgccg
gagacggtggtggaatcggagtttctgtccaagtacagcaagcgtctgaccgaggcccgg
gattggctgcggtcgtactcgtcaacgcgctacaccggcgacattcaatctgcatggaag
ctgtaccacagcgtgtactgcaacatcgacaaacagatcaaatcgagcgacaccctacag
ctgcagttctgcagtccgaagctgtttgaggcgcgcaacctctccatcgggatccccgac
gcgcggcctgttcgcgaggagtcggttgcgaaggtgaaccgctttcagaaagacatcatc
gtcatcgccagcaagcagcggccgaagcggatcggcatcatcacggcggaggggaggttg
cagaagttcctgctcaaagggcgcgaggatctccgcctggacgagcgcgtcatgcagctc
ttctcgctagtcaacatcctcatgcagtccgactcgaggacgagcaagaacttaggcttc
cagatccagcgctactccgtcacgccgctaaaagacaacgtcggcatcattggctgggtc
gacggctgcgacacgctgcacgaggtcgtcaagcactttcgcgaacgcaaatcgatcccg
gtggaactggagatgcgcatgctggaccagatcatcacttttgacaactccaaggcgtac
gactacctgaccatcatgtcgaaggtagaggtgttggagttcctctccgatcacacctcc
gggcaggacattcgcaaggccatgtggaacacgtcgccgaactgcgaggtctggtacgat
cggcgccgcatgtacacaacgtccttggcgaacatgagcatcgtaggctacatcctcggc
ctcggcgaccgccacccaaacaacatcatgctgcagcgcgcgtctggattggtggtgcac
atcgactttggtgactgctttgaggttgccatgacgcgcgacaagttccccgaaaaggta
ccgttccgattgacacgtatgctgcgcagcgcgctcgacgtgtcgggtgtcgacggggcg
tttcgtgcctgctcggagacggcgatgtgcgtgctgcgcgagggcagccacagcgtgcta
gccctcctcgaggcattcattcaagacccgcttatttcgtggcgcctcatcaacagacat
gggcaggagcctgagtcgtcgaacgatcacaagactatcgaagagcaggtgaacattgcc
aacatgcgcaacgccacatcgacggcgggagcggaatccatgtgtgactctgtagggaag
cgcgatagcggtacctttagtgtcgcgaagcacttgtgtggggaggaggtggatgtggtg
catcagggtgtgttcatcgtcaagcgcctcagctccaagctcaaagggcaggactttatc
tcggctggcacggagcccctcgacccacgcacgcaggtagggcagctcatcgaagaagcc
acagacgtcaccaacgtggcacagtcctggtcgggatggtacccgttctggtag

DBGET integrated database retrieval system