KEGG   Leishmania donovani: LDBPK_344230Help
Entry
LDBPK_344230      CDS       T02289                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ldo  Leishmania donovani
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LDBPK_344230
Enzymes [BR:ldo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     LDBPK_344230
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     LDBPK_344230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
34:1689284..1690123
Genome map
AA seq 279 aa AA seqDB search
MEGISEEQRQREEAEIRERDRKRQQEKEEHERRLAEEKAEEERKRRDEEQLRVEEEKRKK
RQEEEWKRLGSDAIQDLPPVPPPVAEEGALDMWYLDDETSQPPLSTASLKPGRKMGAPAV
TMKALRELGVVLFRVSMSDFSVVRQIIKEREYKHTDEIKISQTAKDDSFLERWYQEHYTE
DEQFRVVMDGSFFLDIRSKQDEWIRVHLKAGDLVVLPAGMYHRATLDEDDYVALYRGFQD
APRFVPVKRSDSRADSNQVRLAYLMSLKKGDVATQNGFL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcatttcagaggagcagcgccaacgtgaagaggccgagattcgtgagcgcgac
cgcaagcgccagcaagagaaggaggaacacgagcgccgcctcgcggaggaaaaggcggag
gaggagcgcaagcgtcgcgatgaggagcagctgcgcgtcgaggaggaaaagcgcaaaaag
cggcaggaggaggagtggaagcgtctcggctcagatgcgatccaggacctgccgccggtg
ccaccgccggtggcggaggagggagcgctagacatgtggtaccttgacgacgagacgtct
cagcctccgctgagcaccgccagcctcaaacctgggcgaaagatgggcgctcctgcggtc
accatgaaggcgttgcgggagttgggtgtggtccttttccgcgtcagtatgagcgacttc
tccgtggtaaggcagatcatcaaggaacgcgaatacaagcacaccgacgagatcaaaatc
tcgcagaccgccaaggacgacagctttctcgagcggtggtatcaggaacactacaccgag
gacgagcagtttcgcgtcgtgatggacggctccttcttcctggatatccggtccaagcaa
gacgagtggatccgggtgcacctgaaagcaggtgatcttgtcgttctacctgccggcatg
tatcaccgtgccaccctcgatgaagacgattacgtggcgctctatcgcggcttccaagat
gcaccccgctttgtacccgtcaagcggtccgacagccgtgcagactccaaccaggttcgg
ctggcatacttgatgagtttgaagaagggcgacgtcgccacgcagaacggatttctgtga

DBGET integrated database retrieval system