KEGG   Leishmania donovani: LDBPK_353130Help
Entry
LDBPK_353130      CDS       T02289                                 

Definition
glycerol kinase, glycosomal, putative
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ldo  Leishmania donovani
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ldo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35:complement(1272975..1274513)
Genome map
AA seq 512 aa AA seqDB search
MPYVASIDQGTTSSRCIIFDEKFTVLSAHQLFHKQITPRPGWLEHDPEEIYSNCCLCLAE
ALKKLRSKDPKFDKVSAIGITNQRETGVAWDRKTGKPLCNAIVWSDARTYELSNRIAKEC
GGGDSNFAASITGLPVSTYFTAFKFRWMLENVPAVAAARKSGSLLLGTIETWLLWKLSEG
KVFVTDVSNASRTFLMNLRTQQWCDKLCQELDIPRATLPEIRSNSEHYCNVSANDHGIRD
ALGMPTPVTGCIGDQQSALFGHIGLNKGDAKNTYGTGCFVLMNVGTEPQFSKHGLLGTIA
YKLGTEPTKFALEGSIAGAGATVEWMRSNLGFFDHPMEMESIARKVGSTDGVVFVPAFGG
LLAPYWDPTARGTLVGMTYKTNKSHIIRAALEAISMQVSAVMLAMKEDSGVEINCLRVDG
GLTRSRLLMEMQADILGVNLYVPHLTETTALGAALCAGLAVGVWKSIEEVQKTAKEHLSG
ETVSPITTDEQVRKARLEAWNAAVKLSQWAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgtcgcgtctattgaccagggcaccacctctagtcggtgcatcatcttcgac
gaaaaattcaccgtcctctcagcccaccagctcttccataaacagatcacgccgcgtcct
gggtggctggagcacgatccggaagagatttacagcaactgttgcctctgccttgcagag
gcgctgaagaagctgcgctcaaaagaccccaagttcgacaaagtgtccgcgataggtatc
acgaaccagcgtgagacaggtgtcgcctgggaccgcaagaccgggaagccgctgtgcaac
gccattgtgtggagcgacgcccgtacctatgaattgagcaaccgcatcgcaaaggaatgt
ggtggcggcgacagcaactttgccgccagtattactggcttgcccgtaagcacctacttc
accgccttcaagttccgctggatgctggaaaatgtcccagccgtcgccgccgcgcgcaag
agcggctcgctactcctcggcactatcgagacgtggctgctgtggaagctgagcgagggc
aaggtgtttgtgacggatgtgtcaaacgccagccgcaccttcctaatgaacctgaggacg
cagcagtggtgcgacaagctctgccaggagctcgacattccacgcgcgacactgccggag
attcgcagcaacagcgagcactactgcaatgtctcggccaacgatcacggcatccgcgat
gctctcggcatgccgacgcccgtgacgggctgcattggcgaccagcagagtgccctgttc
ggtcacataggcctgaacaagggtgatgccaagaacacctacggcacgggctgcttcgtg
ctcatgaacgtgggcacggagccgcagttctcgaagcacggtctgctcggcaccattgcg
tacaaactgggtaccgagccgaccaaatttgccctggagggctccattgcgggcgctggc
gccacagtggaatggatgcggtccaaccttggcttcttcgaccaccccatggagatggag
agcatcgcccgcaaagtgggcagcacagacggagtcgtgtttgtgcctgccttcggcggt
cttctcgccccgtactgggacccgacggctcgtggcacccttgtgggcatgacgtacaaa
acgaataagtcgcacataatccgcgccgccctcgaggccatctccatgcaggtgagcgca
gtgatgcttgctatgaaagaggacagcggcgttgagatcaactgcctgcgcgtcgacggt
gggctcacgcgtagtcgcctgctcatggagatgcaggccgacatcctgggtgtgaacctt
tacgtgccgcatctcaccgagacgaccgcccttggcgcagccctttgcgctggcctggcc
gtcggcgtctggaagtctatcgaggaggtacagaagacggccaaggagcaccttagcggt
gagactgtgagccccatcacgacagatgaacaagtgcgcaaggctcgcctggaggcctgg
aacgccgccgtgaagctgtcgcaatgggcgaagctgtaa

DBGET integrated database retrieval system