KEGG   Leishmania donovani: LDBPK_360780Help
Entry
LDBPK_360780      CDS       T02289                                 

Definition
protein kinase, putative
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LDBPK_360780
Protein kinases [BR:ldo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LDBPK_360780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:218838..220208
Genome map
AA seq 456 aa AA seqDB search
MSAEIESHIVKKYEIQAQLGQGAYGIVWRALERKHNRVVALKKIYDAFQNSTDAQRTFRE
IMFLHRLHHPNIIKLLHVHRAFNDRDIYLVFEYMETDLHVVIRANILEEIHKQFIIYQLL
KTMKYLHSAEILHRDMKPSNLLVNSDCTMKVADFGLARSILSLEGEQASRPVLTDYIATR
WYRPPEILLGSTRYTKGVDMWSVGCILGELMLGKPIFPGRSTTNQLELICSVTGMPSAAD
VAATNSQFAHAMLRDIHCAHRRTFAELLPSASADALDLIERLMCFNPNRRMTAAEALEHP
YVAAFHRPDDEPVATEPITVSLPDSQRLPLAKYRDAIYEQIAALRRSSTSADQRQRAERQ
AAGSTASRKTSVSSASAGGSRGGTGTSGVTRPATSSSSSAAAGAAPQRSVVKPTSTSAVN
EASSSKAYARPAFRSATSAASGLESRPVAREAAVRK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccgaaatcgagtcgcatattgtgaagaagtatgagattcaagcacagctagga
cagggtgcctacggcatcgtttggcgcgccctggagcgcaaacacaaccgcgtcgttgca
ctcaagaaaatttacgacgccttccaaaactcgaccgatgcacagcgcaccttccgcgag
atcatgtttctgcaccggctgcaccacccgaacatcatcaagctgctgcacgttcatcgt
gccttcaacgatcgcgacatatacctggtcttcgaatacatggagaccgacctgcacgtg
gtgattagggcaaacatcttggaggaaattcacaaacagttcatcatctaccagctgctc
aagacgatgaagtacctgcattctgctgagattcttcaccgtgatatgaaaccaagcaat
ctgctcgtaaacagcgactgcacaatgaaagtggctgacttcggtctcgcgcgctctatc
ctgtcccttgagggtgagcaggcgtcgcggccggtgctaacggactacattgcgacacgg
tggtaccgcccgccggagattttgctcggctcgacacgatacactaagggcgtggatatg
tggtctgtgggctgcattcttggggagttgatgctgggcaagcccatctttcccggccga
tccaccacgaaccagttggagctgatctgcagcgtgacgggcatgccctccgcggcggat
gtggcggcgaccaactcgcagtttgcccacgcgatgcttcgcgacattcactgcgcgcat
cgacgcacgttcgctgagctgctgccaagcgcttctgccgacgcgctggacctgatcgag
cgccttatgtgtttcaacccaaaccgtcgcatgactgccgccgaggccctggagcacccg
tacgtcgctgcctttcaccgtcctgacgacgaaccggtggcgaccgaacccatcaccgtc
tctctccccgacagccagcgtctgcccttggccaagtacagggacgccatctacgagcaa
attgccgcgctgcgccgtagctccacgtccgccgatcaacgacagcgcgcggagcgacag
gccgccggcagcaccgccagccgcaagacgtccgtcagcagcgcctccgctggcggctct
cgagggggcaccggtacatctggggtcacgcgacccgccacgagcagcagcagcagcgcc
gccgcaggggcggctccgcagcgcagtgttgtgaagcccacctcaaccagcgcggtcaac
gaggcatcatcttcgaaggcgtacgcccgccccgccttccgctcggcaacgtctgccgcc
tctggtctggaaagcagacccgtcgcgcgtgaggcagcggtgcgcaagtga

DBGET integrated database retrieval system