KEGG   Leishmania donovani: LDBPK_361700Help
Entry
LDBPK_361700      CDS       T02289                                 

Definition
clathrin heavy chain, putative
Orthology
K04646  
clathrin heavy chain
Organism
ldo  Leishmania donovani
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ldo04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:complement(640220..645301)
Genome map
AA seq 1693 aa AA seqDB search
MDSPSISAEVFQLNSVSGGLRPGSISFKNVTLESEKYVCVRDVQGDGPTSLVIVDLEKRE
SIRNNVKDAESCIMNPKSKILALRSGRNLQVFDVDASRRLKATLFHEDVAYWRWIDDRTL
GVVTAKAVYHWSLDTAADDAPQHIFDRSADYDSSVQVLSYRSDEQKKWLVVTGVARDPSG
IMVGKALLYSVENRSSRVLDGHACCFISTSTPSEPRKCNVMCLAWNSPQQGGQVMIMELP
TGSKTDLSMLRRVYSVNIQPGDFPVAMNVSDRHKLLTVATSRGSFALMDIFTGTILVEQQ
FSSSVVFCGAADSKVGGVLCVNNQGAVMRIGPNDNGIIGFVKNRMHNAELALRIASTANL
GGVDDLFKVQLDNFLRNGNVEEAVRMCLRAPGNSLRTREILMRFMQMPQQPGQPPAISTY
FKIALAETSLNECESVELARAVVPKGGIGYVKQQFEEGKLTASEELGDLVQQADSNMALK
IFHQGNAHTKVLNLLLQRNETQKAVEYCKRANFSPDWRVIMNNFIRVAPQDAVNLGLMLY
REMGDRPVLTADEVVDMFVSAQQIQQATEFLLEILRDHNDESTMELQTKLLEMNLKYSHP
SVADKIFVRKICQCYDGMKLAPLCERAGLHQHAIDCYIMAQKQDSDLNNLASIRRCLQQL
QNFNPEWLVDFFGKLNKQDSLKCLEDLCTNSRHNFKVIVQVATKYSDALGAADLIDLFLE
HSLYDVLYYYLGAVVPYTRDAEVHFRYIEAAAEMGQMQELERMTRESPCYDAERTKNYLK
SKKLTDMWPFINVCDQHNMVNEMVHYLVETGNESCIEQYLTRRSPGKTPQVVQALIECNV
SEEFIKNMLTAVGTMCPIEELVDCVEEVGRLHLIKQWLEDRRSEKKTDKALYNALAKIYV
DIGQSPEQFLSENEYYDSEVVGKYCETRDPNLAYIAYCRGHCSEMMIDLCHRNGMHKQLA
RYLVKEQNLDLWASVLGQNSAERQQLIESVQQIALPESESSEEVSTTVRAFMNANLTEEL
TSLLGQIVVHGRFRRNRFLENLLIMSAVRARKDKVMEYVTTLEDYDAKDIAHVASGAGMH
EIAFVVYTRHNMQKEAITVLLQDMNDVSRGRAFAQKTDAAVVWSVLGEYLVKQDEVHEGI
ECLIRAKNPDLVVEVTSAAERTNQFGDLIKYLTMARQCSRAKDNKIDTALVITYAKTGRL
EELEEFLKETHNVKIGAIADKCFQDKLYESARVLYTVANNYARVASTEVMLSNLSAAVEA
AKKAKSIHTYKEVNLACIEAGDLKLAGVCAVPVVLKAEEVSGMCNRYESRGLWEELFSVL
RNASSHQGAHMSIFTEMGVLLAKYRPEKLMEHVNMYAKKINTHKMITVCEQYHHWVVLRV
LHINNEDWLAATNSMMQHHADAFDHEIFKDAVSHLGASDLLYTAIGFYLKTHPEQLNDFL
SSIFKRVDPERVMTETKKVAPIHVIRTYLEAAQERNAKKVNEALNNLYIEEEDFKALRHS
VETYNNFDSEELSSRLEKMELFEFRKIALLLHRKNKRYSHAVAVAKENELFEEAIDTAAE
SGDSELVSSLLDYFVKDYPECFAACLYTCYDLLKPATVLQKAWLNQRTEMAMPYMIQVLQ
DYSNKIEKMEKSMMDAQTAAKDAARRAGPVQGPGSVPLMIEQGGGMPMNGMPVGAPPQLG
FGMPPQFGSGRPF
NT seq 5082 nt NT seq  +upstreamnt  +downstreamnt
atggactctccttcgatttctgcggaggtctttcagctcaactcggtctcaggtggcctc
cgcccgggctccatttccttcaagaatgtcaccttagagagcgagaagtatgtctgcgtc
cgcgatgttcagggcgacgggccgacgtcactcgtcattgtcgatctcgagaagcgcgag
agcattcgaaacaatgtcaaggatgcggagtcatgcatcatgaaccccaagtcgaagatc
ctggcactacgcagcggccgcaatctgcaggtgttcgacgtggacgcctcgcggcggctt
aaggcgacgctctttcatgaggatgttgcgtactggcgctggatcgacgaccgcaccctc
ggcgttgtgacggcaaaggcagtctaccactggagcctcgacaccgccgccgacgacgcg
ccgcagcacatcttcgaccgaagcgcggactacgacagcagtgtgcaggtgctctcatac
cgcagcgacgagcagaagaaatggctcgtcgtgactggtgtggcgcgtgacccatcgggt
atcatggtgggcaaggcgctgctgtacagcgtcgagaaccgcagcagtcgcgtgctcgac
ggccatgcgtgctgcttcatctccacctccactccatccgagcctcgcaagtgcaatgtg
atgtgcctcgcctggaacagcccgcagcaaggcggccaggtcatgatcatggagctgccg
accggctccaagacagatttgtcgatgctgcggcgggtttacagcgtaaacattcagccc
ggcgacttcccggtcgccatgaacgtctcggaccgccacaagctgttgaccgtggcgacg
agccggggcagctttgcgctgatggacatcttcaccggaaccatcctggtagagcagcag
ttttcgagctcggtggtgttttgcggcgcagccgacagcaaggtcggcggcgtgttgtgc
gtcaacaaccagggcgccgtcatgcgcatcggccccaacgacaacggtatcatcggcttt
gtcaagaaccgcatgcacaacgccgagctggccctgcgcatcgcctccacggcaaacctg
ggcggcgtcgacgatctcttcaaggtgcagctggacaacttcctgcgcaatggcaacgtc
gaggaggccgtccgcatgtgcctgcgtgccccagggaactcgctgcgcacccgcgagatt
ctcatgcgtttcatgcaaatgccgcagcaaccgggccagccgccggctatctcgacctac
ttcaagatcgcgctggcggagacgagcctgaacgagtgcgagtctgtcgaacttgcgcgc
gcggtggtgcccaagggcggcatcggctacgtgaagcagcagtttgaagagggaaagctg
acggcctccgaggagctcggcgacctggtgcagcaggcggactccaacatggcgctgaag
atcttccaccagggcaatgcccacaccaaggtgctgaacttgctgctgcagcgcaacgag
acgcagaaggcggtggagtactgcaagcgcgcgaacttctcgccggattggcgtgtcatc
atgaacaactttatccgagttgcgccgcaggacgccgtcaaccttggcttgatgctgtac
cgagagatgggcgataggccggtgctcaccgcggatgaggtggtggacatgttcgtgtcg
gcccagcagattcagcaggcgaccgagttccttctggagatcctccgcgaccacaatgac
gagtcgaccatggagctgcaaacgaagctgctcgagatgaacctcaagtactcacatcca
tccgtcgccgataagatcttcgtccgcaagatctgccagtgctacgacggcatgaagctg
gcgccgctttgcgagcgcgctggtctgcaccagcacgcgattgactgctacataatggct
cagaagcaggactccgacctcaacaacctcgccagcatccgccgctgcctgcagcagctg
cagaacttcaaccccgagtggctcgtggactttttcggcaagctcaacaagcaggacagc
ctcaagtgcctcgaggatctctgcaccaactcgcgccacaacttcaaggttattgtgcag
gtggccaccaagtacagtgacgccctcggcgccgccgacctcatcgacctattcctcgag
cacagcctgtacgacgtcctctactactatctcggggccgtggtgccgtacacgcgtgat
gccgaggtgcacttccgctacatcgaggccgctgctgagatgggccaaatgcaggagctg
gagcgcatgacccgcgagagcccgtgctacgacgccgagcggacgaagaactaccttaag
agcaagaaactgacggacatgtggcccttcatcaacgtgtgcgatcagcacaacatggtg
aacgagatggtgcactacctggtggaaacgggcaacgagagctgcatagagcagtacctg
acgcggcgaagccccggtaagacgccgcaggtggtgcaggccctgatcgagtgcaacgtg
agcgaggagttcatcaagaacatgctcacggcggttgggacgatgtgccccattgaagaa
cttgttgactgtgtggaggaggtgggccggctgcacctcatcaagcaatggctcgaggac
cgccgcagcgagaagaagacggacaaggcgctgtacaacgcgctggccaagatctacgtc
gacattggccagagccccgagcagttcctgtcggaaaacgagtattacgattcggaggtg
gtgggcaagtactgcgaaacgcgcgaccccaacctcgcgtacatcgcgtattgccgcggc
cactgcagcgagatgatgatcgacctctgccaccgcaacggcatgcacaagcagctggcc
cgctacctggtgaaagagcagaaccttgatctatgggcgagcgtgctggggcagaactcg
gcggagcggcagcagcttattgagtcggtgcagcagatcgcgctgccagagagtgagtcg
agcgaggaggtgagcacgacggtgcgcgccttcatgaacgccaatctgacggaggagctc
acctcgctgctgggccagattgtggtgcacggccgcttccgcaggaaccgcttcctcgag
aatcttctgatcatgtctgcggtgcgtgcccgcaaggataaggtgatggagtacgtgaca
acgctggaggactacgacgccaaggacattgcgcacgtcgcctcgggcgccggcatgcat
gagatcgcgtttgttgtatacacgcgccacaacatgcagaaggaggccatcacggtgctc
ctgcaggacatgaacgacgtttcgcgcggccgcgcctttgcccaaaagacggacgctgcc
gtcgtgtggtctgtgctaggtgagtacctggtaaagcaggacgaggtgcacgagggtatc
gagtgccttattagggcgaagaaccccgacctcgttgtcgaggtgacgtctgcggcggag
cgcacgaaccagttcggcgacctaatcaagtaccttacgatggcccgccagtgctcgcgc
gcaaaagacaacaagattgacacggcgctcgtcatcacgtacgccaagacgggccgcctc
gaggagctggaggagttcctaaaggagacgcacaacgtcaagatcggcgccattgccgac
aagtgcttccaggacaagctgtacgagtcggcgcgcgtgctgtacaccgtggcgaacaac
tacgctcgcgtggcgtcgacggaggtgatgctgagcaacctgtccgccgccgtagaggcg
gctaagaaggccaagtcgatccacacgtacaaggaggtcaacctggcatgcatcgaggct
ggggatctgaagctggctggggtctgcgccgtcccagtggtgctcaaggcggaggaggtg
agtggcatgtgcaaccgctacgaaagccgcggcctctgggaggagctattctcggtgctc
aggaacgcctctagccatcagggtgcgcacatgtccatcttcaccgagatgggcgtcttg
ctggccaagtatcggcccgagaagctcatggagcacgtgaacatgtacgcgaagaagatc
aacacgcacaagatgattaccgtctgcgagcagtatcaccactgggtcgtgctgcgtgtg
ctgcacatcaacaacgaggattggctggctgcgaccaactcgatgatgcagcaccacgca
gacgccttcgaccacgagatcttcaaggacgcggtgagccacctcggcgccagcgatctc
ctgtacaccgcgattggcttctacctcaagacgcacccggagcagctgaacgacttcctg
tcctccatcttcaagcgcgtggatccggagcgggtgatgacggagacgaagaaggtggca
cctattcacgtgattcgcacctacctcgaggccgcgcaggagcgcaacgccaagaaggtg
aacgaggccctcaacaacctctacatcgaggaggaagacttcaaggcgctgcgccactcc
gtcgagacgtacaacaacttcgactcggaggagctgtcgtcgcggctagagaagatggag
ctctttgagttccgcaagatcgctctgctgctgcaccgcaagaacaagcgctattcgcac
gccgtcgcggtggccaaggagaacgagctgttcgaggaggccatcgacacggcagccgag
agcggcgacagcgagctggtgagcagcctgctggactacttcgtgaaggactatcccgag
tgttttgccgcgtgcctctacacatgctacgacctgctgaagccggcgacggtgttgcag
aaggcgtggctgaatcagcgaacggagatggcgatgccgtacatgattcaggtgctccag
gactactcgaacaagatcgaaaaaatggagaagtcgatgatggacgcgcagactgcggcg
aaggacgcggctcgtcgcgccggtccagtgcaggggcccggctctgtgccgctaatgatc
gagcagggtggcggcatgccgatgaacgggatgccggtcggtgcaccgccgcagttgggc
tttggcatgccgcctcagttcggatctggccggcctttctag

DBGET integrated database retrieval system