KEGG   Leishmania donovani: LDBPK_366580Help
Entry
LDBPK_366580      CDS       T02289                                 

Definition
phosphatidylinositol 3 kinase, putative
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ldo  Leishmania donovani
Brite
Protein kinases [BR:ldo01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   LDBPK_366580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:complement(2454837..2462678)
Genome map
AA seq 2613 aa AA seqDB search
MESKGGVGSSNGSGGTSSNRHPLIGQLRPIFQELESATPQTLPSIILKLEYVIEEEKDAL
FHRNSIKSYTANARTFPNWLNAQLRHLFEQPQTHMAGVQVLRALLPVEYVELNEMTKLFS
ELLVRCVLETADYNTAVEGGEVWGLLLNNGSSVVEGIIINCLQFSLALLMRGGHDEIFLR
EDVSHRGVDSEATVRSAMSPLVDSSRQGENAVLTDDDRFPKATKLSGCIFIQQLVRRVPS
TIAPHVHNILECLRRAILDSNKLVRVSGGDALFYTLTISYRSTDPKFYSRWQNTFLEDAE
RSVMYGSDVVLHGCLLAFNAVLSATASREAEGRAVGFSNQGRKHILQFWTFINDNLVSTS
HNSDVRAEVLNALPLLAQYDSTTFKEISVKHVRALAAAVFVGTEGKDERAMVFQVLARLF
TVLPSLVVPFLDFMMKYIEASLTPQPLRDRCPEAVTCFATLSSVEPNAVRPFLRPLLGPL
FAGSVTEHFARDVAKICTAFPELRSTCLSKVLEATKEQLLRMRNRPRHTSASSETDHSAI
VRSLNSLGSLDFTGYSTLQFLCDAVIRYVSDPHEEVRRSAIDLCFKLALSGCSQSPCERT
AVGVVIHRGREHLGLVNTVIRKLVSAAVADTESDIRLHTLEHLSTEFDYSLALQDICTAL
FPALHDHHQNRIAAVRLLGRLSSRNPSCILPMLRCVMVQCIMDIQLFHEPKRQEQAAVVL
SAVVESAPAMARPYISSLLQDCVTRLQEENKPVPVITALLSLVGRLARYAEDDDVAVVAA
IRPCVIRHILDSSSIQKKIEAIRALGDIIRTTKDVDVYETNPELLRVLLSALHGGFKETW
PVRLDVLKLMGIIGAVDPVRAKEITRHLRDGGLSSSGAAAPAALQLSSSRGEEAIAQNVV
KNVLGVLQLPCLSDDQCLCAVQVIANTLSLKEAASGCLTPMYRDILHTVIQQITLQAKIR
ENLFGVMTHIVYLYGQHIRPYLDELISTCVGFLPAAERGVLVEILCLLREMRRSLREEFS
PSLSLVLPPLIQTVQADAAHSSEPVFAFLIEMGHLLDDHLHNVVPCVCEVASNPAYPVAC
RAAAADAIRHFARRLPRLVFHASRCVHCLCRVLKEMESHPLLFEQQPGASADAAQRRPAA
ELAAGGDTTASDVRSFVAVTLDAVRVVSRNLGSDFEKYTPLVFPLLDGYGQDGQDVKAFT
LSTLRTSGRVVAPENAQAQEEETAARYRVNTQQLAQRRKAALEDNFAQLRSILLARDRET
EEEWNLWLKQLAVELLRSSPSNAHGFAFALAQLHEPFARQMLHSAFAVCYAEMEPRTKEA
VRALLGNVLRSDRVPSEVLQELLNLSEYMERLEMRFNPKEGSHSTYAGLLFDLKTLMGSS
ERCNLYAKALHYVEIQFYEATYEYERNVMRGQVRPLPPEEWSKLVQWCEKSIYLCNLLGL
RESAEGMLKYIQRNFSFLTGKPPSELPLMMDAQLLEKLQWWSQSLRAYEKGLQAEPNKFS
NMVGLMRSLDNLGDYGRLLESWKLFYPRITRKEASELAPYGAHAAWLLRCWDDMEKITAY
MTDEGYVGTTAVFYRAVLATHKLQFHDAVPVIQNCRKRLDSTLSALVAESYDRAYGLFVG
IQQLSELEEFAFVADNPQGLNHWQELWEKRLAAMAYEGWPGTLANHTLVIPLAQELEMWL
RFVSLSRVHGRDRTSRDILFELLGKQTIAAALEQPRLPQPPIALAACQHFYDINERERAV
ELLETYLKKMDQAAPSLLDIGGGQASLAMCHAKLASWLFTVAKKKRQNVDAHYREYIRHH
LEKATSLDSTNGTIWHTWARFNHDLVTHRSRGAASEVRRDEHVKHIVAAMDGYVRSVSCS
QELEDMLGFLSLWFIHAALPQVQENAALQAEILQVSPTVWLKVLPQIIARLHSRDAVVSE
SVFQLLTIVAKAHPQALLYNLNVTLNSSVRGTESNTTEQMERKQAAQRLLGRIKEMHNHG
RTMVKDAALVCQELVRCAVLWTELWFDELERAWFQWGRDKNAHNVFLVLQPLLEQLSHPN
TLAESHFVAEFGELLGGACEYVEKAASTGNNVYMEDAWNRFKTAVKRMDEQINGMNSLAL
QLVSPRLMQSGKDLSLVVPGQYNEDGVYPRIASFQSTLRVMNSKQHPRRLYMTGTDGVLY
KFLLKGHEDLRLDERVMQLLAFVNTLLEKHSAIQRRDCMIQVFSVTPLSENAGLVGWVDN
CDTLHQLIKDYRVHSKYLSIEMNLMLSFNVDLDRLQVIQHVEPFEFALEQTEGADLANSL
WMRAPSAESWLDRRTTYVCSLATMSMVGHILGLGDRHPSNLMIHSFSGRVVHIDFGDCFD
VAQNRSAFPEKVPFRLTRMLVKAMEMGGIDGLFRHGCITVMGVLREEGSSILALLEVFVH
DPLVSWWRDESEDGATASAAVASAAPSSSIPSAGAAAALGHYSQRAAYAAIGESFHKSRT
AFASRTPASRSLAPRGRSFRAPQTSIASSPSAPPPLVSDRSSDILSNMSVNHTSEAKKVV
NRIREKLEGREFAAWQLQASASAHAADDVGVAMKGQSEEDPMTSVSLGSAASAAPVASGE
DGLSVQAQVSRLISEATSNENLCVHFQGWCPFW
NT seq 7842 nt NT seq  +upstreamnt  +downstreamnt
atggagtctaaaggtggcgtaggcagtagcaatggcagcggcggcacgagcagcaatcga
cacccgctgattggtcagctgcgtcccatctttcaagagctggagtcggccacgccgcag
acgctcccctccatcatcctcaagctagagtacgtgatcgaggaggagaaggacgctttg
tttcaccgcaactccatcaagtcctatacggccaatgcacgcacattccccaactggctg
aatgcgcagctacgacacctgtttgagcagccgcagacgcacatggcgggcgtgcaggtg
ctacgggcgctgctgccagtggagtacgtggagctgaatgagatgacgaagctcttttcg
gagctgctggtgcgctgcgtactggagacggcggactacaataccgccgtggagggggga
gaggtgtggggtttgctactcaacaatggcagcagcgtagtcgagggcatcatcatcaac
tgcttacagttttcgttagcactgctgatgcgcggagggcacgatgagatattcttgcgc
gaagacgtgagccatcgcggcgttgacagcgaagcgacggttcgatcggccatgtccccc
ttggtggactcttcgcggcagggcgagaatgctgtcctcacggatgacgatcggttcccc
aaggcaacgaagctgtcggggtgcatcttcattcaacagctggtgcgccgcgtgccatcg
acgattgcgccacacgtgcacaacattcttgagtgcctgcgccgcgccatcctcgactcc
aacaagcttgtgcgcgtgagcggaggcgatgcgctcttttacacgttgaccatttcctat
cgttccaccgacccaaaattctacagccgctggcagaacacatttctcgaagacgcggag
cggagcgtcatgtacggcagcgacgtcgtcctgcatggctgcctgctggccttcaatgcc
gtgctctccgcgacggcatcgcgtgaggccgaagggcgagcagtcggcttctccaaccaa
gggcgaaagcacattctgcagttctggacgtttatcaacgacaacctggtgagcacctcg
cacaacagcgacgtgcgcgccgaggtgctcaacgcactaccgctgctggctcagtacgac
agcactacctttaaagagatttcggtgaagcacgtgcgcgcgctggcggcggcggtgttt
gtcggcacggagggcaaggatgagcgggcaatggtgtttcaggtgctcgcgcggcttttc
acggtgttgcccagccttgtcgtaccgttcctggactttatgatgaagtacatcgaggca
tcgctgacaccgcaacctctccgtgaccgctgccctgaggccgtgacatgcttcgccacg
ctctctagcgtagagccgaacgcggtacgccccttcctacggcccctgcttgggcccctc
ttcgctgggtcggtgacggagcactttgcgcgcgacgtggcgaagatctgcacggccttc
ccagagctgcggtcgacgtgcttgtcgaaggttctagaggcaacaaaggaacagctgcta
cgcatgcgtaaccggccccgacacaccagcgcgtccagcgagacggaccacagtgctatt
gtacgcagcctcaactcgctcgggagccttgacttcacgggatactcgactttgcagttc
ttgtgcgacgccgttattcgatatgtgtcagacccacacgaggaggtgcgccggagcgcg
atcgatctgtgcttcaagctggccctctccggctgctctcagtcgccgtgcgagcgcaca
gccgttggtgtcgtgattcaccgcggtcgggagcacttgggcctggtgaacaccgtcatc
cggaaactggtgagcgcggctgttgcggacaccgagagcgatatccgcctgcacacgctg
gagcacctgagcacggagtttgactactcactggctctgcaggacatctgcacggcgctg
ttccccgccctgcacgaccaccaccagaaccgcatcgcagccgttcgtctcctaggccgc
ctttccagtcgcaacccctcatgcatccttcctatgctgcgttgcgtgatggtgcagtgc
attatggacattcagctcttccacgaaccgaagcggcaggagcaggctgcggtggtgctg
agtgcggtggtggagtccgcgcctgcgatggcacgcccgtacatctcgtctcttttgcaa
gactgcgtaacgcggctgcaggaggagaacaagcctgttccggtgatcacggcgctcctg
tcgcttgtcgggaggctcgcgcggtacgcggaggacgacgacgtggctgtggtggccgcc
attcgaccgtgcgtcattcggcacatcctcgactcgtccagcatccagaaaaagatcgag
gcaattcgcgccttgggcgatatcatccgcaccacaaaggacgtcgacgtgtacgagaca
aatcccgagctgctgcgcgtccttctctccgctctccacggcggcttcaaagaaacgtgg
ccggtgagactggatgtgttgaagctgatgggaattattggcgccgtcgatcctgttcgt
gccaaggagatcacgcgtcacttgcgggatggaggtctgagcagcagtggcgcggctgcc
cctgctgcgttgcagctttcctcctctcgcggggaagaggcgatcgcgcagaatgtcgtc
aagaacgtgctcggcgtcctgcaactgccatgcttatccgatgaccagtgcctctgtgcg
gtgcaggtgatcgcaaacacgctgtcgctcaaggaggcggcgagcgggtgtcttaccccg
atgtatcgcgacattctccatactgttattcagcaaatcactcttcaggctaagatacgc
gagaacctgttcggggtgatgacgcatatcgtgtacctttacggccagcacattcgccca
tacctggacgagctcattagcacgtgcgtcggcttccttcctgctgcagagcgcggcgtc
cttgtggagatactgtgtcttctgagggagatgcgccgctcgctccgtgaagagttcagc
ccttcgctctcgctggtgctgcctccgctcatccagacggttcaggcggacgccgcgcac
tccagcgagcctgtgttcgccttcctcatagagatggggcatttactcgacgaccacctc
cacaacgtcgtgccctgcgtctgcgaggtggcaagtaatcctgcttatccggtggcgtgc
cgtgcggcagctgcggacgccattcgccactttgctcgccgactgccgcgccttgtgttt
cacgcgtcgcgctgcgtgcactgtctatgccgggtgctgaaggagatggagtcgcatcca
ctgctgtttgagcagcaaccaggagcatccgcggacgcggctcagcgccgccctgctgcc
gagctagcggctggcggagacacgacggcctcagacgtgcgcagtttcgtcgccgttacc
ctggacgcagtgcgcgtcgtcagccgcaacctcggtagcgacttcgagaagtacaccccc
ctggtgttcccactgctggacggctacggccaggacggccaggatgtgaaggcattcacg
ctcagcaccctgcgcacgagcggccgcgtggtggcacccgagaacgctcaggcgcaagag
gaggagaccgctgcccggtatcgcgtcaacactcagcagctggctcagcggcgcaaggcc
gcgctggaggacaactttgcgcagctgcgcagcatccttctcgcgcgcgaccgggagacc
gaggaagagtggaacttgtggttgaagcagctggcagtggagctgctacggtcgagtccg
tcgaacgcgcatggcttcgcctttgccctagctcagctgcacgagccctttgcgcggcaa
atgctgcactccgccttcgctgtatgctacgcggaaatggagccgcgcacgaaggaggcg
gttcgcgctcttctcggcaacgtgctccgcagcgaccgcgtgccgtccgaggtgctgcag
gagctgctgaacctgtccgagtacatggagcgactggagatgcgctttaacccaaaggaa
ggctcgcacagcacgtatgccgggctgcttttcgacttgaagacgctgatggggagcagc
gagcgctgcaacttgtacgccaaggcgctgcactacgtcgagattcagttctacgaggcg
acctacgagtacgagcgcaacgtgatgcgcggtcaggtgcgcccgctgccgcctgaggag
tggagcaaacttgtacagtggtgcgagaagagcatttacttgtgcaacctgctgggactg
cgcgagagcgcagagggcatgctcaagtacatccagcgcaatttttcttttctgaccggc
aagcctccgtcagagctgccgcttatgatggacgcgcagctcctcgagaagctgcagtgg
tggtctcagagtttgcgggcgtatgagaagggcctgcaggcggagccgaacaagttcagc
aacatggtcggcctcatgcgctccctcgacaaccttggcgactacggtcggctgctggag
tcgtggaagctcttctacccccgcatcacgcgtaaggaggcctctgagttggccccgtat
ggtgcccacgcagcgtggctgctgcggtgctgggacgacatggagaagatcacagcctac
atgacagatgaaggctacgttggcacgaccgctgtcttttaccgggctgtgctcgccacc
cacaagcttcagttccacgacgccgtaccggtgattcaaaactgccgcaaacgactcgac
tcgacgctgtcggcactcgtggcggaaagctacgaccgcgcctatggtctgtttgttggt
atccagcaactcagtgagctggaggagttcgcatttgttgccgacaacccgcagggcctc
aaccactggcaggagctctgggagaagcggctggctgccatggcctacgaaggctggccc
ggcacgcttgcgaaccacacacttgtcatcccgctggcgcaggagctggagatgtggctg
cggttcgtgtcgctgtcacgcgtgcacggtcgcgaccgcacatcgcgcgacatcctgttc
gagcttctgggcaagcagaccattgcggccgcgctggagcagccgcggctgccgcaacct
ccaattgccctcgccgcctgccagcacttctacgacatcaacgagcgcgaaagggcggtc
gagctgcttgaaacgtacctgaagaagatggatcaggcagccccctctctgctggacatc
gggggcggtcaagcgagcctggccatgtgtcatgcaaagctggcgagctggcttttcacc
gtggcgaagaagaagcggcagaacgttgatgcgcactaccgtgagtacatccgtcaccac
cttgagaaagcgaccagcctcgacagcactaacggcacgatttggcacacgtgggcgcgg
ttcaaccacgaccttgtcacacaccgctcccgcggtgcggcgagcgaggttcgccgcgat
gagcacgttaaacacatcgtggctgccatggacggctatgtgcggagcgtgtcctgctcg
caggagctcgaagacatgctagggtttctctccttgtggttcattcatgccgcgctgccg
caggtgcaagagaatgcggcgctgcaggcggagattcttcaggtgagtccgacggtgtgg
ctcaaggttcttccccaaatcatcgcccgcttgcactcgcgcgacgccgttgtgtcagag
tccgtctttcaactgctcaccattgtcgccaaggcgcacccgcaggcgctcctgtacaac
ctcaatgtcacgctgaactccagcgtgcggggtacagagagcaacacgacggagcagatg
gagcgcaagcaggcggcacagcggttgctcggtcgcataaaggagatgcacaatcatggc
cgcacgatggtcaaggacgccgcccttgtctgccaggagctcgtacggtgcgcagtgctc
tggacggagctgtggtttgatgagcttgagcgagcgtggtttcagtgggggcgcgacaag
aacgctcacaacgtatttcttgtccttcagccgctgctcgagcagctgtcgcaccctaac
accctcgccgagtcgcactttgtggccgagttcggtgagctacttggtggggcctgtgag
tacgtggaaaaggccgcgtcgaccggcaacaatgtctacatggaggatgcgtggaaccgc
ttcaagacggctgtgaagcggatggatgagcagatcaacggcatgaactcacttgccctg
cagctcgtgagtccgcgtctgatgcagagcggcaaggacctttcgctggtggtgccgggg
cagtacaacgaggacggcgtgtacccgcgcatcgcttcctttcaaagcacgttgagggtg
atgaactcaaagcagcacccgcgccgcctttatatgaccggcacggacggcgtcttgtac
aagtttctcctcaagggtcacgaagatctgcggctcgacgagcgcgtcatgcagctgcta
gctttcgtgaacacactgctggagaagcactcggctatccagcgccgtgactgcatgatc
caggtattctctgtcacccccctcagcgagaatgcgggactggttgggtgggtcgacaac
tgcgacacactgcatcaactcattaaggattaccgtgtgcactccaagtacctctccatt
gagatgaacctgatgctgagcttcaacgtcgacctggaccggcttcaggtgattcaacat
gtcgaaccgttcgagtttgcactggagcagacggagggcgccgacctcgccaactcgctg
tggatgcgcgcgccaagcgctgagtcgtggttggaccggcgcaccacttatgtctgttcg
cttgccaccatgtccatggttggccacattttgggcctgggcgaccgccatccgtcgaac
ctgatgatccactcgttcagcggtcgcgtcgtgcacatcgacttcggcgactgcttcgac
gtggcgcaaaaccgtagcgcgttcccagagaaggtgccattccgactgactcgaatgctg
gtcaaggccatggagatgggtggcatcgacggactcttccgccacggctgcatcacggtg
atgggtgtgctgcgcgaggagggtagcagcattctagctctgctggaggttttcgtacac
gacccgcttgtgtcgtggtggcgcgacgagtcggaagacggggcgaccgcatctgctgcc
gtcgcctcggcagcgccgagcagcagcattccgtctgccggcgcggctgcggcactcgga
cactattcgcagcgcgccgcctacgcagccattggtgagtcctttcacaagtcccgcacc
gcctttgcctctcgcacgccagcgtcgcgctcgttggcgccgcgtggtcgctcctttcgc
gcaccacagacctcgatcgcctccagcccttctgctccgcctcccctcgtctccgatcgg
tcgtcagacattttaagcaacatgtcagtcaatcacaccagcgaagcaaagaaagtggtc
aatcgcattcgcgaaaaactcgagggccgcgagtttgccgcgtggcagctccaagccagc
gcctcggcgcacgcggcagatgacgtgggcgtggccatgaaggggcagtcggaagaggac
ccaatgactagtgtcagcttgggcagcgccgcgtctgcagcaccggtggcgagcggcgaa
gacgggctttctgttcaggcgcaggtgagtcggctcatctcggaggctacctccaacgag
aacctgtgcgtccacttccaaggctggtgtccgttttggtga

DBGET integrated database retrieval system