KEGG   Leishmania donovani: LDBPK_366860Help
Entry
LDBPK_366860      CDS       T02289                                 

Definition
protein-L-isoaspartate O-methyltransferase, putative
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ldo  Leishmania donovani
Brite
Enzymes [BR:ldo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LDBPK_366860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36:complement(2568790..2569569)
Genome map
AA seq 259 aa AA seqDB search
MAWHCSSTTNAGMVAALQREGLIKTPEVIEVMRRVDRGWFVRNPKDAYRDQPLPIGFGVT
ISAPHMHAIMLELVSPSVLRHKNLNRGHSQPLRLLDIGSGSGYMTAAFAALCEAAWRDGE
PPMFEVVGIEHVQELQKQSMRVLESHFPEWIRGRRVTLLHGDGRKPRSIAGVGEEKGECF
DVIHVGATAPKSLVPEYLSLLRCGGTLVIPVGSPAEVQELQVFTKGDEGAFTMRRACHVQ
FVPLTSLHAQLDGDVTTRT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcactgctcgtcaacgacgaatgcggggatggtggctgcactgcagcgcgag
ggtctcatcaaaacacccgaggtgattgaggtgatgcgccgtgtggaccgcggatggttc
gtgcgcaaccccaaagatgcttaccgtgatcagcctctgcccatcggtttcggcgtgacc
atcagcgctccacatatgcatgctatcatgttggagctggtgagcccgtctgtgctgcgc
cacaagaatctgaaccgtggccatagccagccgctgcgactgctggacatcggtagtggc
agcggctacatgacggctgcctttgctgcgctgtgtgaggcggcttggcgagacggtgag
ccgccgatgtttgaggtggtcggcatcgagcacgtgcaggagctccagaagcagtcaatg
cgcgtcctcgagtcgcacttccctgagtggatccgcgggcgccgcgtcacgttgctgcac
ggagacggacgaaagcctcgctccatcgcgggtgttggtgaggaaaaaggcgaatgcttt
gacgtcatccacgtcggcgccaccgcgccgaagagtctcgtgcccgagtacctaagcctt
ctccggtgcggtggtacgctggtgattcccgttggtagcccggccgaggtgcaggagtta
caggtgttcacgaagggcgatgaaggcgctttcacgatgcggcgagcgtgtcacgtgcaa
tttgtgccgctcacatctctacatgcccagctcgatggcgacgtgacgacgcgcacgtaa

DBGET integrated database retrieval system