KEGG   Leuconostoc sp. C2: LGMK_00035Help
Entry
LGMK_00035        CDS       T01567                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of PDH complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00010  Glycolysis / Gluconeogenesis
lec00020  Citrate cycle (TCA cycle)
lec00620  Pyruvate metabolism
lec01100  Metabolic pathways
lec01110  Biosynthesis of secondary metabolites
lec01120  Microbial metabolism in diverse environments
lec01130  Biosynthesis of antibiotics
lec01200  Carbon metabolism
Module
lec_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LGMK_00035
   00020 Citrate cycle (TCA cycle)
    LGMK_00035
   00620 Pyruvate metabolism
    LGMK_00035
Enzymes [BR:lec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LGMK_00035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PTS_EIIA_1 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEJ30071
Position
5231..6514
Genome map
AA seq 427 aa AA seqDB search
MTEIFTMPDIGEGMAEGDITSWLVKVGDVVAMDDPVAEVQNDKLLQEILSPYAGKVTHLY
VDAGTTVEVGDPLIEFDGSGTPDTGSDEKTVVETTAPSSEDEVPLVTSDDTTQMVKVANG
HVLAMPSVRHLAFEKGIDLTTVTPTGRHGHVTLSDVESFNKENVSESQAVAPVEVATQQG
TKPNDITPKAPEVLHEGRQPMTPTRRAIAKAMGAQNATIPSVTNFDSVEVSKLVAHRSSF
KAQAQADGVRLTYLAYAVKALAATAKKFPEINASVDMDTNEIIYHEDVNMGIAVNAPSGL
YVPVIMHADQKSILTIAKEIVELSEAVREGSITSQQMRGSTITISNLGSARGTWFTPIIN
GKEVAILGLGTIVKEPMIDENDDIVVGQNMKLSLSYDHRLIDGMLGQAALNYLKQLLADP
AYMLMEV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttacaatgcctgatattggtgagggtatggctgaaggtgatattaca
tcatggcttgttaaagttggtgatgttgtcgcaatggatgatcctgttgctgaagtacaa
aacgataagttacttcaagaaattttgtcaccttatgctggaaaagtcacgcatttatat
gttgatgcagggacaaccgttgaggttggtgatccactaattgagtttgatggtagtggg
acaccagatactggtagcgatgagaaaactgttgtcgaaacaacagcgccttcttctgaa
gatgaagtacctttggtaacgtcagacgatacgactcaaatggttaaggtggctaatggc
catgtgttagctatgccgtctgttcgtcacttagcatttgaaaaaggaattgatttaaca
acggtaacgccaacaggacgtcatggccatgtgacactgtcagatgttgaatcgtttaat
aaagagaacgttagtgaaagtcaagctgtcgcgccagtggaagtggcaacgcaacaaggt
acaaagccaaatgatatcactccgaaggcacctgaagtattgcatgagggtcgacagcca
atgacaccaactcgtcgtgcaattgccaaagcaatgggtgcgcaaaacgcaacgattcct
tcggtgacaaattttgattctgtcgaagtcagtaaactggttgcgcatcgcagtagtttc
aaggcacaggcacaagctgatggtgtccgcttaacgtatctagcatatgctgtaaaagca
ttggcagcaactgccaagaaattccccgagatcaatgcgagtgttgatatggatactaat
gaaattatttatcatgaggatgttaacatgggtattgctgtaaatgccccatcgggatta
tatgtaccagttattatgcatgcagatcagaagtctattttgacgattgctaaagaaatt
gttgagttgtctgaggctgtacgtgagggttcgataacatctcaacaaatgcggggtagt
acgattacgatttctaaccttggttcagcgcgtggcacatggtttacgccaattattaat
ggtaaggaagttgctattttaggattgggaacgattgtgaaagaaccaatgattgatgaa
aacgatgacattgtcgtagggcaaaacatgaagttgtccttgagctacgatcatcgtttg
attgatgggatgttaggacaagcggctctcaactacttaaagcagctgttggctgatcca
gcgtatatgctgatggaggtttaa

DBGET integrated database retrieval system