KEGG   Leuconostoc sp. C2: LGMK_01205Help
Entry
LGMK_01205        CDS       T01567                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lec  Leuconostoc sp. C2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LGMK_01205
Enzymes [BR:lec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LGMK_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255124..256053
Genome map
AA seq 309 aa AA seqDB search
MYNLKTMTKNIVVLGSLNADNIMKMPRMPLVGETMALTDVTTAPGGKGANQAVAAARQGA
NVSFIGAVGNDSNGQFMRATLLTNGVNVDAVTTNGDVPTGSAYIMLQESGANTILIHGGA
NQALTIADIDESVIANADTLIAQFEVPLDVIIAAFKIAKANHVQTILNPAPAVYQLTSEL
MQVTDIILPNETEAQLLSGITVKNDEAVLNRVSNAILSKGVSRCIITLGAAGSFVADGDK
RWWAKPNKVKALDTTGAGDTFIGTLARVIESDFSNLDEAVKQASIASAIAVTRAGAIPSI
PTYDEVATF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttaaaaactatgacaaaaaatattgtcgtacttggcagtttaaatgctgat
aatattatgaaaatgccgcgtatgccattggtaggtgaaacaatggcattaactgatgtg
acaactgcgcctggtggaaaaggggctaatcaagcggtggctgccgcacgtcagggtgca
aatgtttcatttattggtgctgttggaaatgatagtaatggtcaatttatgcgtgccact
ttgttgacaaatggtgtcaatgttgacgctgtgactactaatggtgatgtaccgacggga
tcagcatatatcatgctacaagaaagtggtgctaacacgattttaattcatggaggtgcc
aatcaggcactgactatagcagacattgatgaatcagtgatagcaaatgcggacacattg
attgcacaattcgaggtgccattagacgttattatagcggcttttaaaattgccaaagct
aatcatgtgcaaacaattttaaatcctgcaccagctgtttaccaattaacatccgaatta
atgcaagttacagatattattttgccaaatgaaactgaggcacagctactgtctggtata
acagtaaaaaatgatgaagcggttttgaatcgtgtgagcaacgctattttgtcaaaaggt
gtatcgcgttgcattattaccttgggcgctgcaggttcatttgtggctgacggtgataaa
cgttggtgggcaaaacctaataaagtcaaggcacttgatacgacaggtgcaggagacact
tttattggtactttagcacgtgtcattgaatctgattttagtaatttagatgaggctgta
aagcaagctagcattgctagtgctattgccgtgactcgggcaggtgcgattccatcgatt
cccacatatgatgaggtagccacattctaa

DBGET integrated database retrieval system