KEGG   Leuconostoc sp. C2: LGMK_01230Help
Entry
LGMK_01230        CDS       T01567                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lec  Leuconostoc sp. C2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lec00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LGMK_01230
Enzymes [BR:lec01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LGMK_01230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260015..262402
Genome map
AA seq 795 aa AA seqDB search
MTYQEQQLEKITGTLQNVIFASSDSYFKILSVQIDDSTLENWDETEIIATGTFADVQEGS
VYAFYGSVVRHPKYGQQFKVTRYENELPPDENGLIKYFTSGQFSGIGKKTATKIVEHLGL
NAVNLILDDVHVLDGIVKEPTAKKLMRSLQLNLGLERLFQVGSQFGMGADMAGRLYDQYG
SEAETILNQDPYRLVFEFDGMSFRMADMIGQKIGINRTNERRVQAAVYATITTMSYQYGH
TYLTREKLIQSSVKLIRDFNAEVIVSQAIDHLLADKILVEEDQCLYAATLYLSEIQTAND
LNRLLDASLPFKLSEQAIDDAFITPGQLVLDKTQIAAVKAGLNAQVFLLTGGPGTGKTTI
VRAVVATWHKLLQAQAKYADNTTDFLKSYAVKMASPTGRAAKRMTEVTGYDATTIHRLLG
ISDLDEPEFNADNPITGGLLVVDEASMLDIELTAKLLAAIPNGMKLMIVGDSDQLPSVGP
GNVLADLVDSGKIAHIELDTIYRQGRGSSITTLAQHIKRGELPTDFMENQQDRSTFMVSH
DQTDQAIKQVVQAAVKKGYTQDDLQILTPIYKTTSGVNALNTMAQELFNPAKPAQKSLQF
GTTIFRKGDKILQLENDSERDIYNGDMGKIIAVQYKNDKSNNDHEDRLIVDFDGKEMSYP
KKDLNQLTLAYATTVHKAQGNEFKVVVMALTTRFGLMLNRNLLYTGITRAKEALILVGEY
EAFLHAAQTPVPMRSTRLKARLQNQVVVSSQVSVNSPNVEPKAARNHLTVEMIQSNDISP
LIGLNGITPYDFMPS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaagaacaacaattagaaaaaatcactggtacgttacaaaatgttattttt
gcatcgtcagattcttattttaaaatattatcggttcaaattgacgattcaacgctcgaa
aattgggatgaaacggaaattattgcaacaggtacgtttgctgatgtacaagaaggcagt
gtttatgctttttatggttcggttgttcggcatccaaagtatgggcaacagtttaaagtc
acgcgttatgaaaatgagttaccgcctgatgaaaatggtctaattaagtattttacgagt
ggccaattttctggtattggtaagaaaacagcaactaaaattgttgagcatctgggcttg
aatgctgttaaccttattttagacgatgtacacgtgttggatggtattgttaaagagccc
acggccaagaaattaatgcgaagtctacaattgaatttaggactagagcgattatttcaa
gttggtagccagttcggcatgggtgcagatatggcaggtcgtttatacgatcagtatggt
agtgaagcagaaacaattttgaatcaagatccttatcgccttgtgtttgagtttgatggc
atgtcatttagaatggcagatatgattggtcaaaaaattggtattaatcgtacaaatgaa
cggcgtgtgcaggctgcagtttacgctacaataacaacaatgagctatcagtatggtcat
acttatcttacacgtgaaaaactgatacaatcaagtgtcaagttaattcgagatttcaat
gctgaagtgattgtgtcacaagctattgatcacttgttggcagataaaatcttggtagaa
gaagatcaatgcctttatgctgctacgctatatctttcggaaattcaaactgctaatgat
ttgaatcgcttgttagatgctagtttaccatttaaattgtcagagcaggctattgatgat
gcatttataacacctgggcaactcgtattagataagacgcagattgctgcagttaaagct
ggattaaatgcgcaagttttcctattgactggtggtccaggcactggtaagacaacaatt
gtacgcgctgttgttgcgacttggcataaattgttgcaagcgcaagcaaaatatgctgat
aatacaacagactttttaaagtcctatgctgtaaaaatggcatcaccaacagggcgcgcc
gccaagcgtatgacggaagtcacaggttacgacgcgaccacgattcaccggttgctcgga
atatcagatttagatgaaccagaatttaatgccgataatcctattacaggcggcttactg
gtcgttgatgaagcttcaatgcttgatattgaattaacagcgaaattactagcggctata
ccaaatggcatgaaactcatgatagttggtgactcagaccaactaccttcagttggtcca
gggaacgtcttagctgatcttgtggatagtggtaaaatagcgcatattgagcttgatacc
atttatcgtcagggcaggggcagcagtattacaacactagcccaacatattaagcgtggt
gaattaccaacagatttcatggaaaaccagcaagatcgatcaacttttatggtgtcacat
gaccaaactgatcaagcgattaaacaagtcgttcaagcagccgttaaaaagggttatacg
caggatgatctacaaatattgacacctatttacaagacaacatcaggtgttaatgcactt
aataccatggctcaagaacttttcaacccagctaagccagcccaaaaatcactccaattt
gggacaacgatttttcgcaagggtgataaaatattacaattagaaaatgatagtgagcgt
gatatttataatggtgatatgggtaaaattattgctgtccaatataaaaatgataaaagc
aacaatgatcatgaagatcgtctaattgtagattttgatgggaaagagatgagttaccca
aaaaaggatcttaatcaattaactttggcgtatgccacgaccgttcataaagcccaaggt
aatgaatttaaagtcgttgttatggccttaactactagatttggactgatgcttaatcgt
aatttattatacactggtatcactcgggctaaagaggctttgattttagttggcgaatat
gaagcgtttcttcatgccgcgcaaacgcctgtgccgatgcgttcaacaagattaaaggca
cgattacaaaatcaagtggttgtgtcatctcaagtaagtgttaatagcccgaatgtcgaa
cccaaagcagctaggaatcatttaacagttgaaatgattcaatcaaatgatatttcacca
ttgattggtttaaatggcatcacgccttacgattttatgccaagttaa

DBGET integrated database retrieval system