KEGG   Leuconostoc sp. C2: LGMK_01415Help
Entry
LGMK_01415        CDS       T01567                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lec  Leuconostoc sp. C2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lec00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lec00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
303339..304250
Genome map
AA seq 303 aa AA seqDB search
MRHFLNINAIDERDVLNLVKRALEFKSGIKPNKTTLTVSNLFFENSTRTHSSFQMAENKL
GFQQISVDPQHSSMSKGESLVDTLKTLKAIGVDVAVIRHQMNNWYDYVLNVGGHKIPQLI
NAGDGSGQHPSQSLLDLVTIYEQFGHFDGLHIRIIGDLMHSRVARSNAEVLQSLGVHVTF
SGPESWYVPDLAQFGDFVPIDQDWPKLDVVMFLRVQHERITQTENQSFSTQKYHNQFGLN
LLRYGKLKTNAIVMHPAPVNRDVEIADELVEAPKSRIFEQMTNGVFARMAMLEYIMEVDD
ATD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcgacattttttgaatataaatgcaatagatgaacgtgatgtgctaaacttagtgaaa
cgcgcattagagtttaagtcaggcataaagcctaataagacaactttaaccgttagtaat
ttattttttgaaaattctacgcgtacgcatagtagtttccaaatggcagaaaataaatta
ggctttcagcaaataagtgttgatccacaacatagctcgatgtcaaaaggggagagtttg
gtagatactttaaaaacgttgaaggccattggtgttgatgttgctgtgattaggcatcag
atgaataactggtacgattatgttttaaacgtaggtggtcataaaataccacagctaatt
aatgcaggtgatggcagtggacaacatccatcgcaaagtttactcgatctagtcacaatt
tatgaacaatttggtcattttgatgggctacatattcgaattattggtgacctcatgcat
tcacgagtagcacgttcaaatgctgaggtgttgcagagtttaggcgtgcacgtgacgttt
tctggacctgaaagttggtatgttccagatcttgcacaattcggtgactttgtgccgatt
gatcaggactggcctaaacttgatgtcgtgatgttcttaagggtgcaacatgaacgcatt
acacaaacagaaaatcaaagtttttcaacccaaaaataccataatcagtttgggttaaac
ttgctgcggtacggtaaattgaaaacaaatgcgattgtgatgcaccctgcaccggttaac
cgagatgttgaaattgctgatgaactagttgaagcacctaaatctcgaatttttgaacag
atgactaatggcgtatttgcaagaatggccatgttggaatatataatggaggtggatgat
gcaactgattaa

DBGET integrated database retrieval system