KEGG   Leuconostoc sp. C2: LGMK_01585Help
Entry
LGMK_01585        CDS       T01567                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lec  Leuconostoc sp. C2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lec01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lec00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lec00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336743..337930
Genome map
AA seq 395 aa AA seqDB search
MIKKGYYGEYGGQFIPELLMPAVSAVADAFNHYKDDAAFKDELKDLFDNYANRPSLLYHA
KNMSKDLGGAQIYFKREDLNHTGAHKINNVLGQALIAQRMGKTRLIAETGAGQHGVATAT
AAALFGMEAEIFMGKEDTDRQALNVYRMELLGAKVHVVDTGTMVLKDAVNATFQEWTKRI
DDTFYVLGSAVGPYPFPEMVKYFQSIISEEAREQFLSQTGKLPDAVIAAVGGGSNAIGAF
SKFISDRDVALIGVEAAGKGIHTTQTAATITNGSQGIFHGMKSKFLQSPDGQIDPVYSIS
AGLDYPGIGPEHAYLSDIKRAQYVPITDDEAVQAFEYIARTEGIIAAIESSHAVAYAMKI
APNMKPDQQIMVNLSGRGDKDVAAIARYKGVEINE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaggttactatggcgagtatggtggacagtttattcctgaattattaatg
cctgctgtgagtgctgttgctgatgcatttaatcattacaaagatgatgcagcgtttaaa
gatgagttaaaagatctatttgataattatgctaatcgaccatctttgttgtatcatgct
aaaaacatgtccaaagatcttggcggcgcacaaatatattttaagcgtgaggatctcaat
catacaggtgcacataaaattaacaatgttttgggtcaggcgttaatcgcacagcgaatg
gggaagacaagattaatagctgaaactggagctgggcaacatggtgttgcaacggcgaca
gcggctgcattgtttggtatggaagctgaaattttcatgggtaaggaagacacagatcgt
caagcgctgaatgtctatcgaatggaactgttaggtgcgaaggttcacgtggtggacaca
ggcacaatggttttaaaagatgctgtgaatgcgacttttcaagaatggactaaacgaatt
gatgatacattttatgttttaggatcggcagttggcccttatccgttccctgaaatggtg
aagtactttcaatcgattattagtgaagaggctcgcgaacaatttctaagccaaactggt
aaattaccagatgctgttattgctgctgttggtggcggctcaaatgcgattggtgctttt
agcaaattcatctcagatcgagatgttgcattaatcggcgttgaggcggctggtaaggga
attcatacaacacaaactgcagcaacaattactaatggttcacaaggaatttttcacggt
atgaagtccaaatttttacagtccccagacggacaaattgatccagtttacagtatctca
gctggacttgattatccaggaattgggccggaacacgcctatttatctgacataaagcgt
gcgcaatatgtgcctattacagatgatgaggcagtgcaggcatttgagtatattgcacgc
acggagggaattatagcagcaattgagagttcacatgcggtggcctatgcaatgaaaata
gcgccaaacatgaagccagatcaacaaatcatggtcaatttaagtggtcgtggtgataaa
gatgttgccgccattgcacgatacaaaggagttgaaattaatgagtaa

DBGET integrated database retrieval system