KEGG   Leuconostoc sp. C2: LGMK_01585Help
Entry
LGMK_01585        CDS       T01567                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lec  Leuconostoc sp. C2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LGMK_01585
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGMK_01585
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LGMK_01585
Enzymes [BR:lec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LGMK_01585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
336743..337930
Genome map
AA seq 395 aa AA seqDB search
MIKKGYYGEYGGQFIPELLMPAVSAVADAFNHYKDDAAFKDELKDLFDNYANRPSLLYHA
KNMSKDLGGAQIYFKREDLNHTGAHKINNVLGQALIAQRMGKTRLIAETGAGQHGVATAT
AAALFGMEAEIFMGKEDTDRQALNVYRMELLGAKVHVVDTGTMVLKDAVNATFQEWTKRI
DDTFYVLGSAVGPYPFPEMVKYFQSIISEEAREQFLSQTGKLPDAVIAAVGGGSNAIGAF
SKFISDRDVALIGVEAAGKGIHTTQTAATITNGSQGIFHGMKSKFLQSPDGQIDPVYSIS
AGLDYPGIGPEHAYLSDIKRAQYVPITDDEAVQAFEYIARTEGIIAAIESSHAVAYAMKI
APNMKPDQQIMVNLSGRGDKDVAAIARYKGVEINE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaggttactatggcgagtatggtggacagtttattcctgaattattaatg
cctgctgtgagtgctgttgctgatgcatttaatcattacaaagatgatgcagcgtttaaa
gatgagttaaaagatctatttgataattatgctaatcgaccatctttgttgtatcatgct
aaaaacatgtccaaagatcttggcggcgcacaaatatattttaagcgtgaggatctcaat
catacaggtgcacataaaattaacaatgttttgggtcaggcgttaatcgcacagcgaatg
gggaagacaagattaatagctgaaactggagctgggcaacatggtgttgcaacggcgaca
gcggctgcattgtttggtatggaagctgaaattttcatgggtaaggaagacacagatcgt
caagcgctgaatgtctatcgaatggaactgttaggtgcgaaggttcacgtggtggacaca
ggcacaatggttttaaaagatgctgtgaatgcgacttttcaagaatggactaaacgaatt
gatgatacattttatgttttaggatcggcagttggcccttatccgttccctgaaatggtg
aagtactttcaatcgattattagtgaagaggctcgcgaacaatttctaagccaaactggt
aaattaccagatgctgttattgctgctgttggtggcggctcaaatgcgattggtgctttt
agcaaattcatctcagatcgagatgttgcattaatcggcgttgaggcggctggtaaggga
attcatacaacacaaactgcagcaacaattactaatggttcacaaggaatttttcacggt
atgaagtccaaatttttacagtccccagacggacaaattgatccagtttacagtatctca
gctggacttgattatccaggaattgggccggaacacgcctatttatctgacataaagcgt
gcgcaatatgtgcctattacagatgatgaggcagtgcaggcatttgagtatattgcacgc
acggagggaattatagcagcaattgagagttcacatgcggtggcctatgcaatgaaaata
gcgccaaacatgaagccagatcaacaaatcatggtcaatttaagtggtcgtggtgataaa
gatgttgccgccattgcacgatacaaaggagttgaaattaatgagtaa

DBGET integrated database retrieval system