KEGG   Leuconostoc sp. C2: LGMK_01595Help
Entry
LGMK_01595        CDS       T01567                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lec  Leuconostoc sp. C2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LGMK_01595
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LGMK_01595
Enzymes [BR:lec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LGMK_01595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338945..339733
Genome map
AA seq 262 aa AA seqDB search
MILDELVHVTRENMLTRQREVSLSDLKAKAEQMLVYTDFPVEQALQQPQISVIAEIKQAS
PSKGQIIPTNQFDYMAIARQYELASVDLVSVLTEETYFKGSLNILKSVAKAIDTPVLRKD
FTIDPYMIYEAKVAGASAILLIVAILDDVQLNQYLHLADQLGLSAIVEAHTASEIKRAIA
AKARIIGINNRNLKDFTVDFDNTARLRALVPEGVSVVSESGIRSREDVTLLENINVNGIL
IGETFMKAKDKINMFNILTGRE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaattagtacatgttacacgcgagaatatgttgaccagacaacgtgag
gtatctttatcagatttaaaagcaaaagcagaacaaatgttggtctataccgattttcct
gttgagcaggccttacagcaaccacaaatttctgttatagcagaaattaaacaagcgtca
ccctcaaaaggtcaaattataccaactaatcaatttgattatatggcaattgctcgtcag
tatgagttagcgagtgttgatttagtcagcgttttaacggaagaaacttatttcaaagga
tcattgaatattttgaaatcggtcgcaaaagcaattgatacccctgtactacgcaaagat
ttcacaattgatccctatatgatttacgaagcaaaagttgccggagcatctgctattcta
ttaattgtagctattttggacgacgtgcaattaaatcagtatcttcatttagctgatcaa
ttagggttatcagccattgttgaagcacatactgcttcagaaattaagcgtgccattgct
gcaaaagcgcgtattattggcattaataatcgtaacctcaaagattttacggtggatttt
gataatacagcacgtttacgtgcattggtccctgaaggcgtcagtgttgtctctgagtcg
ggcattcgatcacgtgaagatgtgacattacttgaaaatatcaacgtcaatggcatcttg
attggtgaaactttcatgaaagcaaaagataaaattaatatgtttaacattttaacagga
cgtgaatga

DBGET integrated database retrieval system