KEGG   Leuconostoc sp. C2: LGMK_01595Help
Entry
LGMK_01595        CDS       T01567                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lec  Leuconostoc sp. C2
Pathway
lec00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lec01100  Metabolic pathways
lec01110  Biosynthesis of secondary metabolites
lec01130  Biosynthesis of antibiotics
lec01230  Biosynthesis of amino acids
Module
lec_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LGMK_01595
Enzymes [BR:lec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LGMK_01595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AEJ30379
Position
338945..339733
Genome map
AA seq 262 aa AA seqDB search
MILDELVHVTRENMLTRQREVSLSDLKAKAEQMLVYTDFPVEQALQQPQISVIAEIKQAS
PSKGQIIPTNQFDYMAIARQYELASVDLVSVLTEETYFKGSLNILKSVAKAIDTPVLRKD
FTIDPYMIYEAKVAGASAILLIVAILDDVQLNQYLHLADQLGLSAIVEAHTASEIKRAIA
AKARIIGINNRNLKDFTVDFDNTARLRALVPEGVSVVSESGIRSREDVTLLENINVNGIL
IGETFMKAKDKINMFNILTGRE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaattagtacatgttacacgcgagaatatgttgaccagacaacgtgag
gtatctttatcagatttaaaagcaaaagcagaacaaatgttggtctataccgattttcct
gttgagcaggccttacagcaaccacaaatttctgttatagcagaaattaaacaagcgtca
ccctcaaaaggtcaaattataccaactaatcaatttgattatatggcaattgctcgtcag
tatgagttagcgagtgttgatttagtcagcgttttaacggaagaaacttatttcaaagga
tcattgaatattttgaaatcggtcgcaaaagcaattgatacccctgtactacgcaaagat
ttcacaattgatccctatatgatttacgaagcaaaagttgccggagcatctgctattcta
ttaattgtagctattttggacgacgtgcaattaaatcagtatcttcatttagctgatcaa
ttagggttatcagccattgttgaagcacatactgcttcagaaattaagcgtgccattgct
gcaaaagcgcgtattattggcattaataatcgtaacctcaaagattttacggtggatttt
gataatacagcacgtttacgtgcattggtccctgaaggcgtcagtgttgtctctgagtcg
ggcattcgatcacgtgaagatgtgacattacttgaaaatatcaacgtcaatggcatcttg
attggtgaaactttcatgaaagcaaaagataaaattaatatgtttaacattttaacagga
cgtgaatga

DBGET integrated database retrieval system