KEGG   Leuconostoc sp. C2: LGMK_01605Help
Entry
LGMK_01605        CDS       T01567                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lec  Leuconostoc sp. C2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LGMK_01605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGMK_01605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LGMK_01605
Enzymes [BR:lec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LGMK_01605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340359..341126
Genome map
AA seq 255 aa AA seqDB search
MVEKIETVLKHGKGFISFVVAGDPNFDKSADYIVALAEAGADVVEIGIAFSDPSADGETI
MKADLRAAAAGSTTTKVFELVEKVRQRTQVPLVFLTYTNTVFTYGYEAFLAKMKQYEVQG
IIMPDLPLEEQAEFVALAEKYQRSFIQLVTLKSGKRIPDIVKHASGFVYVVSSLGITGTR
QNLSADAYDLITQINQLTDVPTAVGFGVSHPDQVSQFSNAQAVIVGSAIVKIIAAHPFDA
EQYLQTFVKGMKAVW
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaaatagagacagttttgaaacatggcaaaggatttattagttttgtcgtt
gctggggatcctaattttgataaaagtgctgactacattgtcgcacttgcagaagcaggc
gcagatgttgtggaaattggaattgctttttcagatccatctgcggatggcgaaacaatt
atgaaagctgatttgcgtgcagctgcagctggttcaacaaccacaaaagtatttgaatta
gttgaaaaggtacgtcaacgaacacaggtaccattggttttcttaacgtatacaaatact
gtgtttacctacggatatgaagcattcttagccaagatgaaacaatatgaagttcaaggg
attattatgccagatttgccattagaagagcaggcagaatttgtcgcacttgctgaaaaa
tatcaacgttcatttattcaattagtcactttaaaatcaggaaagcgaatacctgatatt
gtcaagcatgcatctggatttgtttatgttgttagctctcttggcattactggaacacgg
caaaatttatcagctgatgcttatgacctgattacacaaattaatcagttgactgatgtg
ccgacagccgttgggtttggcgttagtcatccagatcaagtctcacagtttagcaatgcg
caggcggtaattgttggatcagctattgttaagatcatcgctgcacatccctttgatgct
gaacaatatctacaaacatttgttaaaggtatgaaggcagtgtggtaa

DBGET integrated database retrieval system