KEGG   Leuconostoc sp. C2: LGMK_01605Help
Entry
LGMK_01605        CDS       T01567                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lec  Leuconostoc sp. C2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lec00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LGMK_01605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LGMK_01605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LGMK_01605
Enzymes [BR:lec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LGMK_01605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
340359..341126
Genome map
AA seq 255 aa AA seqDB search
MVEKIETVLKHGKGFISFVVAGDPNFDKSADYIVALAEAGADVVEIGIAFSDPSADGETI
MKADLRAAAAGSTTTKVFELVEKVRQRTQVPLVFLTYTNTVFTYGYEAFLAKMKQYEVQG
IIMPDLPLEEQAEFVALAEKYQRSFIQLVTLKSGKRIPDIVKHASGFVYVVSSLGITGTR
QNLSADAYDLITQINQLTDVPTAVGFGVSHPDQVSQFSNAQAVIVGSAIVKIIAAHPFDA
EQYLQTFVKGMKAVW
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaaatagagacagttttgaaacatggcaaaggatttattagttttgtcgtt
gctggggatcctaattttgataaaagtgctgactacattgtcgcacttgcagaagcaggc
gcagatgttgtggaaattggaattgctttttcagatccatctgcggatggcgaaacaatt
atgaaagctgatttgcgtgcagctgcagctggttcaacaaccacaaaagtatttgaatta
gttgaaaaggtacgtcaacgaacacaggtaccattggttttcttaacgtatacaaatact
gtgtttacctacggatatgaagcattcttagccaagatgaaacaatatgaagttcaaggg
attattatgccagatttgccattagaagagcaggcagaatttgtcgcacttgctgaaaaa
tatcaacgttcatttattcaattagtcactttaaaatcaggaaagcgaatacctgatatt
gtcaagcatgcatctggatttgtttatgttgttagctctcttggcattactggaacacgg
caaaatttatcagctgatgcttatgacctgattacacaaattaatcagttgactgatgtg
ccgacagccgttgggtttggcgttagtcatccagatcaagtctcacagtttagcaatgcg
caggcggtaattgttggatcagctattgttaagatcatcgctgcacatccctttgatgct
gaacaatatctacaaacatttgttaaaggtatgaaggcagtgtggtaa

DBGET integrated database retrieval system