KEGG   Leuconostoc sp. C2: LGMK_01630Help
Entry
LGMK_01630        CDS       T01567                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lec  Leuconostoc sp. C2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lec00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344574..345074
Genome map
AA seq 166 aa AA seqDB search
MTVAYLSLGANIGDRLANLQQAVTLLQETIGIDVTDISNVYETQPVGGVVQDDFYNLALR
VDTNLSVLELLARLHEIESRLKRVRKVHWGPRTIDIDILVFGDDVWSDDTLTVPHREMAN
RRFVLTPLLDVVSDDRRYEIENLLAHTTDTNWVRVVANVRVENDNV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcttatttaagtttaggtgctaatattggggatcgactggctaatttgcaa
caagcagtgacgctattacaggaaactatagggatagacgttactgatatttcaaatgtt
tatgagacgcaaccagtaggtggtgtggttcaggatgatttttataatttagctttgcgg
gtggatactaatttatcagtccttgaattattagcgcgtttacatgaaattgaatctcgt
ttaaaacgcgttcgtaaagtccattggggaccgcgtacaattgatattgatattttagta
tttggggatgatgtgtggtcagacgatactttgaccgttccacatcgtgagatggcgaat
cgtcggtttgtactgacgcctttgttagatgtcgtgtcggatgatcggcgctacgaaatt
gaaaatttattagcgcatacaacggatacaaattgggttcgtgttgtggctaatgtgaga
gtagaaaatgacaatgtttaa

DBGET integrated database retrieval system